DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and LRRC4C

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001245348.1 Gene:LRRC4C / 57689 HGNCID:29317 Length:640 Species:Homo sapiens


Alignment Length:507 Identity:134/507 - (26%)
Similarity:200/507 - (39%) Gaps:117/507 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLY 153
            ||.:||:|..:..|  |.|:.::|.::|:.|..||::|::..|::|.:....|  .:|.:|:.|.
Human    46 TCPSVCSCSNQFSK--VICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSF--KHLRHLEILQ 106

  Fly   154 LRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNT 218
            |....|..||...|.||.||..|:|..|.|.|:|:.|..::..|:||.|.:|.|..|.|.||...
Human   107 LSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRI 171

  Fly   219 PSLHKLDLSH-------------------------CD---------------------------- 230
            |||.:|||..                         |:                            
Human   172 PSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRP 236

  Fly   231 ------------------IQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIET-LSRLHGIELHD 276
                              ||.|...||..||.|..:.|..|.|: |||..:.| |..|..|.||.
Human   237 GSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLT-LLPHDLFTPLHHLERIHLHH 300

  Fly   277 NPWLCDCRLRDTKLWL---MKRNIPYPVAPVCS--GGPERIIDRSFADLHVDEFAC-RPEMLPIS 335
            |||.|:|.:    |||   :|...|...| .|:  ..|..:..|...:|..:.|.| .|.::...
Human   301 NPWNCNCDI----LWLSWWIKDMAPSNTA-CCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP 360

  Fly   336 HYVEAAMGENASITCRARAVPAANINWYW-NGRLLANNSAFTAYQ-RIHMLEQVEGGFEKRSKLV 398
            ..:....|..|.:.||| :....:::|.. ||.::.:.    ||: ||.:|..        ..|.
Human   361 ADLNVTEGMAAELKCRA-STSLTSVSWITPNGTVMTHG----AYKVRIAVLSD--------GTLN 412

  Fly   399 LTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSGQIVGLSAALVALIVFALGVIM 463
            .||....|:..:.|:..|..|...|:.||:|:.......|.       .|...|..:..:.....
Human   413 FTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSY-------FSTVTVETMEPSQDEAR 470

  Fly   464 CLLLRVKRQPYVDSKTPNHMEVITSVNHQNSITNK---TQPATG-NGSIGGV 511
            .....|...|.||.:|.|   |.||:..|::.:.:   |.|.|. |..|.|:
Human   471 TTDNNVGPTPVVDWETTN---VTTSLTPQSTRSTEKTFTIPVTDINSGIPGI 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/18 (28%)
LRR_RI <119..277 CDD:238064 63/229 (28%)
leucine-rich repeat 123..148 CDD:275380 6/24 (25%)
LRR_8 148..207 CDD:290566 23/58 (40%)
leucine-rich repeat 149..172 CDD:275380 9/22 (41%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR_8 195..255 CDD:290566 27/130 (21%)
leucine-rich repeat 197..220 CDD:275380 10/22 (45%)
leucine-rich repeat 221..244 CDD:275380 11/93 (12%)
leucine-rich repeat 245..268 CDD:275380 9/23 (39%)
LRRCT 277..327 CDD:214507 16/54 (30%)
IG_like 338..429 CDD:214653 23/92 (25%)
Ig 346..426 CDD:143165 20/81 (25%)
LRRC4CNP_001245348.1 LRRNT 47..80 CDD:214470 12/34 (35%)
PPP1R42 65..235 CDD:411060 45/171 (26%)
LRR 1 77..98 6/22 (27%)
leucine-rich repeat 78..101 CDD:275380 6/24 (25%)
LRR 2 101..122 7/20 (35%)
leucine-rich repeat 102..125 CDD:275380 9/22 (41%)
LRR 3 125..146 9/20 (45%)
leucine-rich repeat 126..149 CDD:275380 8/22 (36%)
LRR 4 149..170 10/20 (50%)
leucine-rich repeat 150..173 CDD:275380 10/22 (45%)
LRR 5 173..195 5/21 (24%)
leucine-rich repeat 174..198 CDD:275380 4/23 (17%)
LRR 6 198..219 1/20 (5%)
leucine-rich repeat 199..220 CDD:275380 1/20 (5%)
LRR_8 220..279 CDD:404697 10/58 (17%)
LRR 7 220..241 0/20 (0%)
leucine-rich repeat 221..244 CDD:275380 0/22 (0%)
LRR 8 244..265 5/20 (25%)
leucine-rich repeat 245..268 CDD:275380 6/22 (27%)
LRR_8 267..>301 CDD:404697 14/34 (41%)
LRR 9 268..289 7/21 (33%)
leucine-rich repeat 269..290 CDD:275380 8/21 (38%)
LRRCT 301..>339 CDD:214507 13/42 (31%)
IG 360..443 CDD:214652 23/95 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..483 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41933
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.