DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and ISLR2

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_065902.1 Gene:ISLR2 / 57611 HGNCID:29286 Length:745 Species:Homo sapiens


Alignment Length:599 Identity:131/599 - (21%)
Similarity:200/599 - (33%) Gaps:158/599 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLY 153
            :|...|||..|...|..:|..:.|.::||.:..|...|.:|.||:..|                 
Human    19 SCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVL----------------- 66

  Fly   154 LRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNT 218
                     .|..|..:|.:..|.|:||.:.||...||..:..|:.|.|:.|.|.........|.
Human    67 ---------RRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLRNL 122

  Fly   219 PSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDC 283
            .:|..|.::|..:.::...|.|.|..|..||:|.|:|..|.|.|.:.||.|..::|:.||:.|.|
Human   123 SALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGC 187

  Fly   284 RLRDTKLWLM------KRNIPYPVAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHY--VEA 340
            .|    :||.      :.::|.|.:..|:..|..   :......:....|.|..:.:|..  :||
Human   188 GL----VWLQAWAASTRVSLPEPDSIACASPPAL---QGVPVYRLPALPCAPPSVHLSAEPPLEA 245

  Fly   341 -----AMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLT 400
                 ..|....:.|.|...|...:.|..                     |:.||.......||:
Human   246 PGTPLRAGLAFVLHCIADGHPTPRLQWQL---------------------QIPGGTVVLEPPVLS 289

  Fly   401 NAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSGQIVGLSAALVALIVFALGVIMCL 465
            ...:...:|        .|..|.:..|....:|.......:......:...:||   |.|.::..
Human   290 GEDDGVGAE--------EGEGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLAL---ANGSLLVP 343

  Fly   466 LLRVKRQPYVDSKTPNHMEV-ITSVNHQNSITNKTQPATGNGSIGGVVIANGAVANIIDGGVVQG 529
            ||..|.......:..|.:.. .||:....:.|...:.|.|.|...             ||   |.
Human   344 LLSAKEAGVYTCRAHNELGANSTSIRVAVAATGPPKHAPGAGGEP-------------DG---QA 392

  Fly   530 GTLERKSSGRGGVPHGVHDQRSANPVQKPPRLTDLPYSTQGYDNNGSVLSTASCF----ISPSGS 590
            .|.||||:.:|          ..|.|        ||...:| ...|..|:..|..    ..|...
Human   393 PTSERKSTAKG----------RGNSV--------LPSKPEG-KIKGQGLAKVSILGETETEPEED 438

  Fly   591 TGNGGNNPDLI------------NDTKRFGS----DEFADLK---------------------IP 618
            |..|....|.|            .|..|:.|    ::.|:||                     :.
Human   439 TSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELKPHVFELGVIALDVAEREARVQLT 503

  Fly   619 PIS---GVGVGGSG 629
            |::   |.|.||:|
Human   504 PLAARWGPGPGGAG 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 5/18 (28%)
LRR <122..>277 CDD:443914 42/154 (27%)
leucine-rich repeat 123..148 CDD:275380 5/24 (21%)
leucine-rich repeat 149..172 CDD:275380 2/22 (9%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
leucine-rich repeat 221..244 CDD:275380 6/22 (27%)
leucine-rich repeat 245..268 CDD:275380 10/22 (45%)
LRRCT 277..327 CDD:214507 11/55 (20%)
IG_like 338..429 CDD:214653 16/95 (17%)
Ig strand B 346..350 CDD:409353 0/3 (0%)
Ig strand C 359..363 CDD:409353 0/3 (0%)
Ig strand E 395..399 CDD:409353 0/3 (0%)
Ig strand F 409..414 CDD:409353 1/4 (25%)
Ig strand G 422..425 CDD:409353 1/2 (50%)
ISLR2NP_065902.1 leucine-rich repeat 36..52 CDD:275380 4/15 (27%)
LRR <51..>183 CDD:443914 43/157 (27%)
LRR 1 52..73 8/46 (17%)
leucine-rich repeat 53..76 CDD:275380 7/48 (15%)
LRR 2 76..97 8/20 (40%)
leucine-rich repeat 77..100 CDD:275380 8/22 (36%)
LRR 3 100..123 6/22 (27%)
leucine-rich repeat 101..124 CDD:275380 6/22 (27%)
LRR 4 124..145 4/20 (20%)
leucine-rich repeat 125..148 CDD:275380 6/22 (27%)
LRR 5 148..169 9/20 (45%)
leucine-rich repeat 149..172 CDD:275380 10/22 (45%)
PCC 154..>228 CDD:188093 21/80 (26%)
Ig_3 232..359 CDD:464046 26/158 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..326 7/46 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..466 27/125 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 656..722
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.