DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrrc4cb

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_005166545.1 Gene:lrrc4cb / 564462 ZFINID:ZDB-GENE-080327-5 Length:631 Species:Danio rerio


Alignment Length:425 Identity:110/425 - (25%)
Similarity:178/425 - (41%) Gaps:110/425 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQF--IR-ANLLNLQ 150
            ||.:||:|..:..|  |.|..|.|..:|:.:..||:.|::..|::|.:..:.|  :| ..:|.|.
Zfish    47 TCPSVCSCSNQFSK--VICTRRGLKDVPDGVSTNTRYLNLQDNQIQVIKVDSFKHLRHLEILQLS 109

  Fly   151 KLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAF 215
            :.::||.:||     .|.|||:|..|:|..|.|.|:|:.|..::..|:||.|.:|.|..|.|.||
Zfish   110 RNHIRNIEIG-----AFNGLTSLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSDAF 169

  Fly   216 GNTPSLHKLDLSHCD-IQTISAQAFGGLQGLTLLRL----------------------NGNKLSE 257
            ...|||.:|||.... :..||:.||.||..|..|.|                      :||:|:.
Zfish   170 SRLPSLRRLDLGELKRLSYISSGAFQGLSNLRYLNLGMCNLKEVPNIQPLIRLDELEMSGNQLTV 234

  Fly   258 LLPKT----------------IETLSR-----LHG---------------------------IEL 274
            :.|.:                ::|:.|     ||.                           :.|
Zfish   235 IQPSSFKGLVHLQKLWMMHAQVQTIERNSFDDLHSLRELNLAHNNLTFLPHDLYTPLHHLQRVHL 299

  Fly   275 HDNPWLCDCRLRDTKLWL---MKRNIPYPVAPVCS--GGPERIIDRSFADLHVDEFACRPEML-- 332
            |.|||.|:|.:    |||   ::..:|...: .|:  ..|..:..|...:|....|.|...::  
Zfish   300 HHNPWNCNCDI----LWLSWWLRETVPTNTS-CCARCNSPPSLKGRYIGELDQSYFQCYAPVIIE 359

  Fly   333 -PISHYVEAAMGENASITCRARAVPAANINWYW-NGRLLANNSAFTAYQRIHMLEQVEGGFEKRS 395
             |:.  :....|..|.:.||..:|  .:::|.. ||.::.:.   |...||::  |.:|      
Zfish   360 PPVD--LNLTEGMAAELKCRTNSV--TSVSWLTPNGSIITHG---TLKMRINV--QNDG------ 409

  Fly   396 KLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS 430
            .|..||....|:..:.|...|..|...|:..|:|:
Zfish   410 TLNFTNVTLQDTGTYTCYVSNMLGNTSASAILNVT 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 5/18 (28%)
LRR <122..>277 CDD:443914 60/228 (26%)
leucine-rich repeat 123..148 CDD:275380 6/27 (22%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
leucine-rich repeat 197..220 CDD:275380 10/22 (45%)
leucine-rich repeat 221..244 CDD:275380 10/23 (43%)
leucine-rich repeat 245..268 CDD:275380 8/60 (13%)
LRRCT 277..327 CDD:214507 14/54 (26%)
IG_like 338..429 CDD:214653 22/91 (24%)
Ig strand B 346..350 CDD:409353 1/3 (33%)
Ig strand C 359..363 CDD:409353 0/3 (0%)
Ig strand E 395..399 CDD:409353 1/3 (33%)
Ig strand F 409..414 CDD:409353 1/4 (25%)
Ig strand G 422..425 CDD:409353 1/2 (50%)
lrrc4cbXP_005166545.1 LRRNT 48..81 CDD:214470 12/34 (35%)
LRR 76..>303 CDD:443914 60/231 (26%)
leucine-rich repeat 79..102 CDD:275380 5/22 (23%)
leucine-rich repeat 103..126 CDD:275380 9/27 (33%)
leucine-rich repeat 127..150 CDD:275380 8/22 (36%)
leucine-rich repeat 151..174 CDD:275380 10/22 (45%)
leucine-rich repeat 175..199 CDD:275380 10/23 (43%)
leucine-rich repeat 200..221 CDD:275380 3/20 (15%)
leucine-rich repeat 222..245 CDD:275380 4/22 (18%)
leucine-rich repeat 246..269 CDD:275380 3/22 (14%)
leucine-rich repeat 270..291 CDD:275380 0/20 (0%)
LRRCT 302..352 CDD:214507 14/54 (26%)
Ig 355..443 CDD:472250 23/102 (23%)
Ig strand B 372..376 CDD:409353 1/3 (33%)
Ig strand C 383..387 CDD:409353 0/3 (0%)
Ig strand E 409..413 CDD:409353 2/9 (22%)
Ig strand F 423..428 CDD:409353 1/4 (25%)
Ig strand G 436..439 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.