DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrrc4cb

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_005166545.1 Gene:lrrc4cb / 564462 ZFINID:ZDB-GENE-080327-5 Length:631 Species:Danio rerio


Alignment Length:425 Identity:110/425 - (25%)
Similarity:178/425 - (41%) Gaps:110/425 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQF--IR-ANLLNLQ 150
            ||.:||:|..:..|  |.|..|.|..:|:.:..||:.|::..|::|.:..:.|  :| ..:|.|.
Zfish    47 TCPSVCSCSNQFSK--VICTRRGLKDVPDGVSTNTRYLNLQDNQIQVIKVDSFKHLRHLEILQLS 109

  Fly   151 KLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAF 215
            :.::||.:||     .|.|||:|..|:|..|.|.|:|:.|..::..|:||.|.:|.|..|.|.||
Zfish   110 RNHIRNIEIG-----AFNGLTSLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSDAF 169

  Fly   216 GNTPSLHKLDLSHCD-IQTISAQAFGGLQGLTLLRL----------------------NGNKLSE 257
            ...|||.:|||.... :..||:.||.||..|..|.|                      :||:|:.
Zfish   170 SRLPSLRRLDLGELKRLSYISSGAFQGLSNLRYLNLGMCNLKEVPNIQPLIRLDELEMSGNQLTV 234

  Fly   258 LLPKT----------------IETLSR-----LHG---------------------------IEL 274
            :.|.:                ::|:.|     ||.                           :.|
Zfish   235 IQPSSFKGLVHLQKLWMMHAQVQTIERNSFDDLHSLRELNLAHNNLTFLPHDLYTPLHHLQRVHL 299

  Fly   275 HDNPWLCDCRLRDTKLWL---MKRNIPYPVAPVCS--GGPERIIDRSFADLHVDEFACRPEML-- 332
            |.|||.|:|.:    |||   ::..:|...: .|:  ..|..:..|...:|....|.|...::  
Zfish   300 HHNPWNCNCDI----LWLSWWLRETVPTNTS-CCARCNSPPSLKGRYIGELDQSYFQCYAPVIIE 359

  Fly   333 -PISHYVEAAMGENASITCRARAVPAANINWYW-NGRLLANNSAFTAYQRIHMLEQVEGGFEKRS 395
             |:.  :....|..|.:.||..:|  .:::|.. ||.::.:.   |...||::  |.:|      
Zfish   360 PPVD--LNLTEGMAAELKCRTNSV--TSVSWLTPNGSIITHG---TLKMRINV--QNDG------ 409

  Fly   396 KLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS 430
            .|..||....|:..:.|...|..|...|:..|:|:
Zfish   410 TLNFTNVTLQDTGTYTCYVSNMLGNTSASAILNVT 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/18 (28%)
LRR_RI <119..277 CDD:238064 60/231 (26%)
leucine-rich repeat 123..148 CDD:275380 6/27 (22%)
LRR_8 148..207 CDD:290566 22/58 (38%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR_8 195..255 CDD:290566 27/82 (33%)
leucine-rich repeat 197..220 CDD:275380 10/22 (45%)
leucine-rich repeat 221..244 CDD:275380 10/23 (43%)
leucine-rich repeat 245..268 CDD:275380 8/60 (13%)
LRRCT 277..327 CDD:214507 14/54 (26%)
IG_like 338..429 CDD:214653 22/91 (24%)
Ig 346..426 CDD:143165 20/80 (25%)
lrrc4cbXP_005166545.1 LRRNT 48..81 CDD:214470 12/34 (35%)
LRR_8 77..137 CDD:290566 21/64 (33%)
leucine-rich repeat 79..102 CDD:275380 5/22 (23%)
LRR_RI 82..>281 CDD:238064 56/203 (28%)
leucine-rich repeat 103..126 CDD:275380 9/27 (33%)
LRR_8 125..180 CDD:290566 23/54 (43%)
leucine-rich repeat 127..150 CDD:275380 8/22 (36%)
leucine-rich repeat 151..174 CDD:275380 10/22 (45%)
leucine-rich repeat 175..199 CDD:275380 10/23 (43%)
leucine-rich repeat 200..221 CDD:275380 3/20 (15%)
LRR_8 221..280 CDD:290566 8/58 (14%)
leucine-rich repeat 222..245 CDD:275380 4/22 (18%)
leucine-rich repeat 246..269 CDD:275380 3/22 (14%)
leucine-rich repeat 270..291 CDD:275380 0/20 (0%)
LRRCT 302..352 CDD:214507 14/54 (26%)
I-set 355..443 CDD:254352 23/102 (23%)
Ig 372..439 CDD:143165 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12164
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8422
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.