DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrit1a

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a / 553943 ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio


Alignment Length:551 Identity:129/551 - (23%)
Similarity:212/551 - (38%) Gaps:136/551 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QSTCQTVCACKW----KGGK-QTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANL 146
            :|||.|.|:|.:    .|.: ::|.|.|..:..:|.....:|..|.:....::.:.:|.|  :.|
Zfish    20 RSTCPTQCSCFYHNLSDGSRARSVICNDPEISLVPASFPGDTSKLRIEKTAIKRIPSEAF--SYL 82

  Fly   147 LNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIE 211
            .||:.|::....:..:..::|:||.:|.||.|..|.|.:.|..:|..:||||.|.:.:|.:..:.
Zfish    83 SNLEFLWMSFNVLSSLNSDSFRGLYSLEELRLDGNSLSSFPWESLMDMPSLRLLDIHNNQLSSLP 147

  Fly   212 SQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHD 276
            |:|.....::..||||..::.|:.|:...  ..||:....|.:.|:|:            :.|||
Zfish   148 SEAALYMKNITYLDLSSNNLLTVPAEVLN--TWLTIKPTLGAESSKLI------------LGLHD 198

  Fly   277 NPWLCDCRLRDTKLWLMKRNIPYPVAPVCS----------GGPERIIDRSFADLHVDEFACR-PE 330
            |||||||||.|.        :.:..:|..|          ..||.:....|:|..:..  |: |.
Zfish   199 NPWLCDCRLYDL--------VQFQKSPSLSVAFIDTRLRCADPESLSGVLFSDAELRR--CQGPR 253

  Fly   331 MLPISHYVEAAMGENASITCRARAVPAANINWY------WNGRLLANNSAFTAYQRIHMLEQVEG 389
            :......|.:|:|.|..:.|....||...:.|.      .||.:|..||.             ||
Zfish   254 VHTAVARVRSAVGNNVLLRCGTVGVPIPELAWRRADGKPLNGTVLLENSK-------------EG 305

  Fly   390 GFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSGQIVGLSAALVAL 454
              ...|.|.:......|:.::.|.|.|.||.||                           |:::|
Zfish   306 --IVWSILSVPAVSYRDTGKYICKATNYAGSAE---------------------------AVISL 341

  Fly   455 IVFALGVIMCLLLRVKRQPYVDSKTPNHMEVITSVNHQNSITNKTQPATGNG-SIGGVVIANGAV 518
            |:.....:....|..|  |.:.||.||.|  :.:...:..|.....|...|| .:.|.|      
Zfish   342 IINDAPKMENPTLDPK--PKLKSKKPNTM--VKAAYQEKHIATYVSPTPKNGLPLSGTV------ 396

  Fly   519 ANIIDGGVVQGGTLERKSSGRGGVPHGVHDQRSANPVQKPPRLTDLPYSTQGY-DNNGSVLSTAS 582
                              |..|..| |:....:||     .|:.....|..|: :.|.|.|    
Zfish   397 ------------------SYTGPYP-GMESDNAAN-----SRMNTQTASPDGFLETNLSNL---- 433

  Fly   583 CFISPSGSTGNGGNNPD-LINDTKRFGSDEF 612
                 :.:|.:...:|| ::...|..|..::
Zfish   434 -----AANTSSLQQDPDRVVRSVKVIGDTDY 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 4/18 (22%)
LRR_RI <119..277 CDD:238064 40/157 (25%)
leucine-rich repeat 123..148 CDD:275380 5/24 (21%)
LRR_8 148..207 CDD:290566 20/58 (34%)
leucine-rich repeat 149..172 CDD:275380 5/22 (23%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR_8 195..255 CDD:290566 17/59 (29%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
leucine-rich repeat 221..244 CDD:275380 6/22 (27%)
leucine-rich repeat 245..268 CDD:275380 5/22 (23%)
LRRCT 277..327 CDD:214507 16/59 (27%)
IG_like 338..429 CDD:214653 25/96 (26%)
Ig 346..426 CDD:143165 21/85 (25%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378 5/24 (21%)
LRR_8 63..119 CDD:290566 15/57 (26%)
LRR_RI <77..175 CDD:238064 31/99 (31%)
leucine-rich repeat 85..108 CDD:275378 5/22 (23%)
LRR_8 108..167 CDD:290566 20/58 (34%)
leucine-rich repeat 109..132 CDD:275378 8/22 (36%)
leucine-rich repeat 133..156 CDD:275378 6/22 (27%)
leucine-rich repeat 157..170 CDD:275378 4/12 (33%)
LRRCT 199..243 CDD:214507 15/51 (29%)
I-set 252..343 CDD:254352 28/132 (21%)
Ig 259..333 CDD:299845 21/88 (24%)
fn3 448..515 CDD:278470 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.