DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrrc4ca

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001018583.1 Gene:lrrc4ca / 553785 ZFINID:ZDB-GENE-050522-533 Length:647 Species:Danio rerio


Alignment Length:426 Identity:120/426 - (28%)
Similarity:172/426 - (40%) Gaps:112/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQF--IR-ANLLNLQ 150
            ||.:||:|..:..|  |.|..|.|..:|:.|..||:.|::..|.:|.:..:.|  :| ..:|.|.
Zfish    47 TCPSVCSCSNQFSK--VICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLS 109

  Fly   151 KLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAF 215
            |.::||.:||     .|.||.||..|:|..|.|.|:|:.|..::..|:||.|.:|.|..|.|.||
Zfish   110 KNHIRNIEIG-----AFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAF 169

  Fly   216 GNTPSLHKLDLS----------------------------------------------------- 227
            ...|||.:|||.                                                     
Zfish   170 NRVPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSI 234

  Fly   228 ------------------HCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIET-LSRLHGIE 273
                              |..||||...||..||.|..|.|..|.|: |||..:.| |..|..:.
Zfish   235 IRPGSFKGLVHLQKLWMMHAQIQTIERNAFDDLQSLVELNLAHNNLT-LLPHDLFTPLHHLERVH 298

  Fly   274 LHDNPWLCDCRLRDTKLWL---MKRNIPYPVAPVCS--GGPERIIDRSFADLHVDEFAC-RPEML 332
            ||.|||.|:|.:    |||   :|..:|...: .|:  ..|.....|...:|..:.|.| .|.::
Zfish   299 LHHNPWNCNCDI----LWLSWWLKEMVPANTS-CCARCSSPTSHKGRYIGELDQNYFHCYAPVIV 358

  Fly   333 PISHYVEAAMGENASITCRARAVPAANINWYWNGRLLANNSAFT--AYQ-RIHMLEQVEGGFEKR 394
            .....:....|..|.:.|||.::  .:::|     :..|.|..|  ||: ||.:|..        
Zfish   359 EPPADLNVTEGMAAELKCRANSL--TSVSW-----ITPNGSIMTHGAYKIRISVLND-------- 408

  Fly   395 SKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS 430
            ..|..||....|:..:.|:..|.||...|:.||:||
Zfish   409 GTLNFTNVTMQDTGTYTCMVSNSAGNTTASATLNVS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 6/18 (33%)
LRR_RI <119..277 CDD:238064 65/232 (28%)
leucine-rich repeat 123..148 CDD:275380 6/27 (22%)
LRR_8 148..207 CDD:290566 23/58 (40%)
leucine-rich repeat 149..172 CDD:275380 9/22 (41%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR_8 195..255 CDD:290566 29/130 (22%)
leucine-rich repeat 197..220 CDD:275380 10/22 (45%)
leucine-rich repeat 221..244 CDD:275380 12/93 (13%)
leucine-rich repeat 245..268 CDD:275380 10/23 (43%)
LRRCT 277..327 CDD:214507 15/54 (28%)
IG_like 338..429 CDD:214653 25/93 (27%)
Ig 346..426 CDD:143165 22/82 (27%)
lrrc4caNP_001018583.1 LRRNT 48..81 CDD:214470 13/34 (38%)
LRR <78..288 CDD:227223 59/215 (27%)
leucine-rich repeat 79..102 CDD:275380 5/22 (23%)
leucine-rich repeat 103..126 CDD:275380 10/27 (37%)
leucine-rich repeat 127..150 CDD:275380 8/22 (36%)
leucine-rich repeat 151..174 CDD:275380 10/22 (45%)
leucine-rich repeat 175..199 CDD:275380 4/23 (17%)
leucine-rich repeat 200..221 CDD:275380 0/20 (0%)
leucine-rich repeat 222..245 CDD:275380 0/22 (0%)
leucine-rich repeat 246..269 CDD:275380 8/22 (36%)
leucine-rich repeat 270..291 CDD:275380 9/21 (43%)
LRRCT 302..>340 CDD:214507 12/42 (29%)
IG 361..443 CDD:214652 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12164
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8422
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.