DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrit1b

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001036218.1 Gene:lrit1b / 553432 ZFINID:ZDB-GENE-060616-45 Length:654 Species:Danio rerio


Alignment Length:395 Identity:103/395 - (26%)
Similarity:163/395 - (41%) Gaps:89/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKW----KGGK-QTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLN 148
            :|...|:|.:    .|.| ::|.|.|..|..||::...:...|.:....|..:|:..|  ..|.:
Zfish    22 SCPAQCSCFYHKLSDGSKSRSVLCNDPDLTDIPDNFPLDASKLRIEKTSLSRISSAPF--QQLSS 84

  Fly   149 LQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQ 213
            |:.|::....:..|..:||:||..|.||.:..|:|.:.|...|..:||||.|.|.:|.|..|.::
Zfish    85 LEYLWISFNSLSSISPDTFRGLYALDELRMDGNVLTSFPWECLLDMPSLRLLDLHNNKISSIPAE 149

  Fly   214 AFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETL-----------S 267
            |     :|:                   ::.||.|.|:.|.|:.:.|:.:.:.           |
Zfish   150 A-----TLY-------------------IRNLTYLDLSSNSLTTVPPEVLMSWFSPKPPLDAEGS 190

  Fly   268 RLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSG----GPERIIDRSFADLHVDEFACR 328
            |:. :.||||||.|||||.|  |...::.....||.:.:|    .||.:....|:|..:     |
Zfish   191 RMI-LGLHDNPWQCDCRLFD--LVQFQKFPSSSVAFIDTGLRCAEPESLSGVLFSDAEL-----R 247

  Fly   329 PEMLPISH----YVEAAMGENASITCRARAVPAANINWY------WNGRLLANNSAFTAYQRIHM 383
            ...:|..|    .|.:::|.|..:.|....||...::|.      .||         |..|.:  
Zfish   248 RCQIPRVHTAVARVRSSIGNNVLLRCGTIGVPIPELSWARADGKPMNG---------TVQQEV-- 301

  Fly   384 LEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS----------MRAAGMAS 438
              ..||..  .|.|.:......||.::.|.|.|..|.|:|..:|.:|          .|:.|..|
Zfish   302 --SKEGII--WSILSVPAVSYRDSGKYVCKATNFVGSADAIISLVISDTWQIDEAVAKRSHGKKS 362

  Fly   439 LGSGQ 443
            .|.|:
Zfish   363 GGFGR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 6/18 (33%)
LRR <122..>277 CDD:443914 41/165 (25%)
leucine-rich repeat 123..148 CDD:275380 5/24 (21%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
leucine-rich repeat 221..244 CDD:275380 1/22 (5%)
leucine-rich repeat 245..268 CDD:275380 7/33 (21%)
LRRCT 277..327 CDD:214507 17/53 (32%)
IG_like 338..429 CDD:214653 24/96 (25%)
Ig strand B 346..350 CDD:409353 0/3 (0%)
Ig strand C 359..363 CDD:409353 0/3 (0%)
Ig strand E 395..399 CDD:409353 2/3 (67%)
Ig strand F 409..414 CDD:409353 1/4 (25%)
Ig strand G 422..425 CDD:409353 1/2 (50%)
lrit1bNP_001036218.1 LRR <50..>175 CDD:443914 40/150 (27%)
leucine-rich repeat 64..84 CDD:275378 5/21 (24%)
leucine-rich repeat 85..108 CDD:275378 7/22 (32%)
leucine-rich repeat 109..132 CDD:275378 7/22 (32%)
leucine-rich repeat 133..156 CDD:275378 9/46 (20%)
leucine-rich repeat 157..170 CDD:275378 6/12 (50%)
leucine-rich repeat 185..203 CDD:275378 8/18 (44%)
LRRCT 199..243 CDD:214507 16/45 (36%)
Ig 252..343 CDD:472250 26/105 (25%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 282..286 CDD:409353 0/3 (0%)
Ig strand E 309..313 CDD:409353 2/3 (67%)
Ig strand F 323..328 CDD:409353 1/4 (25%)
FN3 459..526 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.