DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrit1b

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001036218.1 Gene:lrit1b / 553432 ZFINID:ZDB-GENE-060616-45 Length:654 Species:Danio rerio


Alignment Length:395 Identity:103/395 - (26%)
Similarity:163/395 - (41%) Gaps:89/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCQTVCACKW----KGGK-QTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLN 148
            :|...|:|.:    .|.| ::|.|.|..|..||::...:...|.:....|..:|:..|  ..|.:
Zfish    22 SCPAQCSCFYHKLSDGSKSRSVLCNDPDLTDIPDNFPLDASKLRIEKTSLSRISSAPF--QQLSS 84

  Fly   149 LQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQ 213
            |:.|::....:..|..:||:||..|.||.:..|:|.:.|...|..:||||.|.|.:|.|..|.::
Zfish    85 LEYLWISFNSLSSISPDTFRGLYALDELRMDGNVLTSFPWECLLDMPSLRLLDLHNNKISSIPAE 149

  Fly   214 AFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETL-----------S 267
            |     :|:                   ::.||.|.|:.|.|:.:.|:.:.:.           |
Zfish   150 A-----TLY-------------------IRNLTYLDLSSNSLTTVPPEVLMSWFSPKPPLDAEGS 190

  Fly   268 RLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSG----GPERIIDRSFADLHVDEFACR 328
            |:. :.||||||.|||||.|  |...::.....||.:.:|    .||.:....|:|..:     |
Zfish   191 RMI-LGLHDNPWQCDCRLFD--LVQFQKFPSSSVAFIDTGLRCAEPESLSGVLFSDAEL-----R 247

  Fly   329 PEMLPISH----YVEAAMGENASITCRARAVPAANINWY------WNGRLLANNSAFTAYQRIHM 383
            ...:|..|    .|.:::|.|..:.|....||...::|.      .||         |..|.:  
Zfish   248 RCQIPRVHTAVARVRSSIGNNVLLRCGTIGVPIPELSWARADGKPMNG---------TVQQEV-- 301

  Fly   384 LEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS----------MRAAGMAS 438
              ..||..  .|.|.:......||.::.|.|.|..|.|:|..:|.:|          .|:.|..|
Zfish   302 --SKEGII--WSILSVPAVSYRDSGKYVCKATNFVGSADAIISLVISDTWQIDEAVAKRSHGKKS 362

  Fly   439 LGSGQ 443
            .|.|:
Zfish   363 GGFGR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 6/18 (33%)
LRR_RI <119..277 CDD:238064 41/168 (24%)
leucine-rich repeat 123..148 CDD:275380 5/24 (21%)
LRR_8 148..207 CDD:290566 21/58 (36%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 195..255 CDD:290566 16/59 (27%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
leucine-rich repeat 221..244 CDD:275380 1/22 (5%)
leucine-rich repeat 245..268 CDD:275380 7/33 (21%)
LRRCT 277..327 CDD:214507 17/53 (32%)
IG_like 338..429 CDD:214653 24/96 (25%)
Ig 346..426 CDD:143165 20/85 (24%)
lrit1bNP_001036218.1 LRR_RI <59..168 CDD:238064 35/134 (26%)
leucine-rich repeat 64..84 CDD:275380 5/21 (24%)
LRR_8 83..143 CDD:290566 21/59 (36%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
LRR_8 131..>176 CDD:290566 18/68 (26%)
LRR_4 131..172 CDD:289563 17/64 (27%)
leucine-rich repeat 133..156 CDD:275380 9/46 (20%)
leucine-rich repeat 157..175 CDD:275380 7/17 (41%)
leucine-rich repeat 185..203 CDD:275378 8/18 (44%)
LRRCT 199..243 CDD:214507 16/45 (36%)
I-set 252..343 CDD:254352 26/105 (25%)
IGc2 265..333 CDD:197706 19/82 (23%)
FN3 459..526 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25552
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.