DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and Lgr6

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001414286.1 Gene:Lgr6 / 498233 RGDID:1560339 Length:965 Species:Rattus norvegicus


Alignment Length:244 Identity:73/244 - (29%)
Similarity:105/244 - (43%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DP-PAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLD----------------- 127
            || |...:..|...|.|:..|...:.:|.:..|.::|..:||.|..||                 
  Rat    25 DPQPGPGRPACPAPCHCQEDGIMLSADCSELGLSEVPADLDPLTAYLDLSMNNLTELQPGLFHHL 89

  Fly   128 -------MSGNKLQTLSNEQF----------IRANLL------------NLQKLYLRNCKIGEIE 163
                   :|||.|..:..:.|          :::|.|            :||.|.|....|..:.
  Rat    90 RFLEELRLSGNHLSHIPRQAFSGLHSLKILMLQSNQLRGIPAEALWELPSLQSLRLDANLISLVP 154

  Fly   164 RETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSH 228
            ..:|:||::|..|.|..|.|..:|..||.::|:|:.:|||.|.|..|...||.|..||..|.|.:
  Rat   155 ERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRIRHIPDYAFQNLTSLVVLHLHN 219

  Fly   229 CDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDN 277
            ..||.:...:|.||..|..|.||.|:|.| .|..|.||.||..:..|:|
  Rat   220 NRIQHVGTHSFEGLHNLETLDLNYNELQE-FPVAIRTLGRLQELGFHNN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 4/18 (22%)
LRR <122..>277 CDD:443914 60/200 (30%)
leucine-rich repeat 123..148 CDD:275380 10/70 (14%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
leucine-rich repeat 197..220 CDD:275380 10/22 (45%)
leucine-rich repeat 221..244 CDD:275380 8/22 (36%)
leucine-rich repeat 245..268 CDD:275380 11/22 (50%)
LRRCT 277..327 CDD:214507 1/1 (100%)
IG_like 338..429 CDD:214653
Ig strand B 346..350 CDD:409353
Ig strand C 359..363 CDD:409353
Ig strand E 395..399 CDD:409353
Ig strand F 409..414 CDD:409353
Ig strand G 422..425 CDD:409353
Lgr6NP_001414286.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.