DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and swi2

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster


Alignment Length:201 Identity:52/201 - (25%)
Similarity:81/201 - (40%) Gaps:61/201 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FKGLTNLVELDLSHNLLVTVPSL----------ALGH------IPSLRELTLASNHIHKIESQAF 215
            :.|:.||..|:.|..|....|:|          .|.|      :|.||.||:..:...:.:.. |
  Fly    86 YGGMNNLAALNQSGKLSRVQPALEMLLCGWPKDGLNHFRDLQKLPRLRSLTIEYSGFTEFKFD-F 149

  Fly   216 GNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSE-----LLPKTIETLSRLHGIELH 275
            .....||.:::|..::..||::.|..:..|.:|.|..|:|.:     |||:..|.|      .|.
  Fly   150 PEMLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLDGPLLLPRNFEQL------YLA 208

  Fly   276 DNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSGGPER---IIDRSFADLHVDEFAC------RPEM 331
            .|||.|   .|:.| ||:.:             ||:   ::||       ||..|      ..:|
  Fly   209 GNPWNC---TRNFK-WLLLQ-------------PEKGRLVVDR-------DELICTDRKYKERQM 249

  Fly   332 LPISHY 337
            |.:.||
  Fly   250 LMVMHY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380
LRR_RI <119..277 CDD:238064 33/130 (25%)
leucine-rich repeat 123..148 CDD:275380
LRR_8 148..207 CDD:290566 15/55 (27%)
leucine-rich repeat 149..172 CDD:275380 1/4 (25%)
leucine-rich repeat 173..196 CDD:275380 8/38 (21%)
LRR_8 195..255 CDD:290566 16/59 (27%)
leucine-rich repeat 197..220 CDD:275380 5/22 (23%)
leucine-rich repeat 221..244 CDD:275380 6/22 (27%)
leucine-rich repeat 245..268 CDD:275380 10/27 (37%)
LRRCT 277..327 CDD:214507 14/52 (27%)
IG_like 338..429 CDD:214653 52/201 (26%)
Ig 346..426 CDD:143165
swi2NP_611247.3 LRR <117..384 CDD:227223 44/170 (26%)
leucine-rich repeat 132..154 CDD:275378 5/22 (23%)
leucine-rich repeat 155..178 CDD:275378 6/22 (27%)
leucine-rich repeat 179..201 CDD:275378 8/21 (38%)
leucine-rich repeat 202..214 CDD:275378 6/17 (35%)
leucine-rich repeat 287..307 CDD:275378
leucine-rich repeat 308..332 CDD:275378
leucine-rich repeat 333..357 CDD:275378
leucine-rich repeat 358..385 CDD:275378
leucine-rich repeat 386..398 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.