DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and Lrrc24

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001129368.1 Gene:Lrrc24 / 362945 RGDID:1308720 Length:521 Species:Rattus norvegicus


Alignment Length:446 Identity:117/446 - (26%)
Similarity:176/446 - (39%) Gaps:73/446 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANL 146
            ||  :.:.|...|.|.    ..||||....|..:|..|.|.||.|.:..|.:..|  ||...|.|
  Rat    25 PP--RATGCPAACRCY----SATVECGALRLRVVPPGIPPGTQTLFLQDNSIAHL--EQGALAPL 81

  Fly   147 LNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIE 211
            ..|:.|||.|..:..:|...|:....|:||.|:.|.|..:...|...:..||.|.||.|.:.|:.
  Rat    82 AALRHLYLHNNTLRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQLRVLYLAGNQLAKLL 146

  Fly   212 SQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHD 276
            ...|.:.|.|.:|.|....|:.:..||..||..|.||.|:.|:|..:..:.::.||.|..:.|.:
  Rat   147 DFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKEALQPLSSLQVLRLTE 211

  Fly   277 NPWLCDCRLRDTKLWLM---KRNIPYPVAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHYV 338
            |||.|||.|.....|:.   :|.:......:....|.|:..:|..::......|    :|.|...
  Rat   212 NPWRCDCALHWLGSWIKEGGRRLLSSRDKKITCAEPPRLALQSLLEVSGGSLIC----IPPSVNA 272

  Fly   339 E-----AAMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGF------- 391
            |     |.:||:..:.|:|...|...:.|   .::|.........|     .|:|||.       
  Rat   273 EPPELTANLGEDLQVACQASGYPQPLVVW---RKMLQPRDGKPQAQ-----VQLEGGAPGLGGHA 329

  Fly   392 ---EKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHV------------------------ 429
               .....|.|||.....:.::.|.|.|..|.|...|.|.|                        
  Rat   330 TRDTGSGMLFLTNITLAHAGKYECEATNAGGKARVLFHLLVNASRQQSQQLPAPQAPATRPVGQE 394

  Fly   430 --------SMRAAGMASLGSGQIVGLSAALVALIVFALGVIMCLLLRVKRQPYVDS 477
                    :.||.|:|:..:   :..:.||:||....|..::|...|.:::..|.|
  Rat   395 PQHEGGSMAFRALGLATQTA---ITAAIALLALTALLLAAMICRRRRRRKKMPVPS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 7/18 (39%)
LRR_RI <119..277 CDD:238064 52/157 (33%)
leucine-rich repeat 123..148 CDD:275380 9/24 (38%)
LRR_8 148..207 CDD:290566 20/58 (34%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 195..255 CDD:290566 22/59 (37%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
leucine-rich repeat 221..244 CDD:275380 8/22 (36%)
leucine-rich repeat 245..268 CDD:275380 7/22 (32%)
LRRCT 277..327 CDD:214507 12/52 (23%)
IG_like 338..429 CDD:214653 25/105 (24%)
Ig 346..426 CDD:143165 19/89 (21%)
Lrrc24NP_001129368.1 leucine-rich repeat 61..83 CDD:275380 8/23 (35%)
PPP1R42 63..>212 CDD:411060 48/150 (32%)
LRR_8 84..142 CDD:404697 20/57 (35%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
PCC 188..>259 CDD:188093 18/70 (26%)
Ig_3 267..357 CDD:404760 22/97 (23%)
Ig strand A 267..271 CDD:409353 2/3 (67%)
Ig strand A' 276..280 CDD:409353 0/3 (0%)
Ig strand B 283..292 CDD:409353 2/8 (25%)
Ig strand C 298..304 CDD:409353 1/8 (13%)
Ig strand D 330..333 CDD:409353 0/2 (0%)
Ig strand E 336..342 CDD:409353 2/5 (40%)
Ig strand F 349..357 CDD:409353 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.