Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246198.1 | Gene: | CG14762 / 35768 | FlyBaseID: | FBgn0033250 | Length: | 498 | Species: | Drosophila melanogaster |
Alignment Length: | 214 | Identity: | 68/214 - (31%) |
---|---|---|---|
Similarity: | 99/214 - (46%) | Gaps: | 38/214 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 LIQIPE---HIDPNTQVLDMSGNKLQTLSNEQF------------------IRANLLN----LQK 151
Fly 152 LYLRNCKIGEIERETFKGL-TNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAF 215
Fly 216 -GNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKL----SELLPKTIETLSRLHGIELH 275
Fly 276 DNPWLCDCRLRDTKLWLMK 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 4/12 (33%) |
LRR_RI | <119..277 | CDD:238064 | 57/185 (31%) | ||
leucine-rich repeat | 123..148 | CDD:275380 | 8/42 (19%) | ||
LRR_8 | 148..207 | CDD:290566 | 25/63 (40%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 195..255 | CDD:290566 | 21/60 (35%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 221..244 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 245..268 | CDD:275380 | 9/26 (35%) | ||
LRRCT | 277..327 | CDD:214507 | 7/18 (39%) | ||
IG_like | 338..429 | CDD:214653 | |||
Ig | 346..426 | CDD:143165 | |||
CG14762 | NP_001246198.1 | leucine-rich repeat | 85..105 | CDD:275380 | |
LRR_RI | 93..384 | CDD:238064 | 53/169 (31%) | ||
leucine-rich repeat | 107..129 | CDD:275380 | |||
leucine-rich repeat | 131..154 | CDD:275380 | |||
LRR_8 | 154..214 | CDD:290566 | 68/214 (32%) | ||
leucine-rich repeat | 155..178 | CDD:275380 | |||
leucine-rich repeat | 179..203 | CDD:275380 | |||
leucine-rich repeat | 204..227 | CDD:275380 | 4/12 (33%) | ||
LRR_8 | 226..286 | CDD:290566 | 11/59 (19%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 2/22 (9%) | ||
LRR_8 | 276..335 | CDD:290566 | 25/58 (43%) | ||
leucine-rich repeat | 276..300 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 325..349 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 349..409 | CDD:290566 | 21/62 (34%) | ||
leucine-rich repeat | 350..373 | CDD:275380 | 7/22 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |