DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and rdo

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster


Alignment Length:583 Identity:131/583 - (22%)
Similarity:210/583 - (36%) Gaps:152/583 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKG 169
            ||.:.|:...:     ...:.||:|||.||.|..:.|  .::..|:.|..|||::.:|..:.:..
  Fly   167 VELVQRNFFML-----SRLKYLDLSGNPLQDLQPDVF--RDVPELKVLKCRNCQLKKINPQMYNL 224

  Fly   170 LTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTI 234
            |..|.||||..|....:.......:..|.::.|..|.:..:..|.|....||:.||||:..:..:
  Fly   225 LPLLSELDLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKV 289

  Fly   235 SAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCR-LRDT---------- 288
            ...:|..|..||.|.|:.|||..|.|::|.:||.|..:.:..|. |.|.| :|:|          
  Fly   290 PNDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNV-LMDLREMRETFEPLIYYFFL 353

  Fly   289 ---KLWLMKRNIP------------YPVAPVCSGGPERIIDRSFADLH------VDEFACRP-EM 331
               ||:.  :.||            .||..:......|.::.|...|:      :|  .||. |.
  Fly   354 TCSKLFF--QLIPQLTHLAIADMGTMPVGLLHPFKQLRYLNISGNSLNNTALEVID--PCRELEF 414

  Fly   332 LPISHYVEAAMGENASITCRA-RAVPAAN-------------------INWYWNGRLLANNSAFT 376
            |.:|......:.|:..:..:. |.|...|                   :.|.|:           
  Fly   415 LDLSRNQLHGISEDTVLRIQGIRNVRLDNNPLICDECHMGKLINVVRQLQWKWD----------- 468

  Fly   377 AYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGS 441
            .|....:.:.:.|.......:   |...| ...|....|..|.....||..|..:..  :|.|| 
  Fly   469 TYPICFLPKSLRGAEINNLDI---NGLHT-CLTFITDEEQNAASTSYNFLEHGGLNT--LAILG- 526

  Fly   442 GQIVGLSAALVALIVFALGVIMCLLLR----VKRQPYVDSKTPNHME------VITSVNHQNS-- 494
                |:...|:|:|:  |.::.|....    ..|:.:::......:|      .||::.:.:|  
  Fly   527 ----GIIFVLIAVII--LSLVACFSKNRARYYTREDHLNGSESKCLEKNLEATTITTLGNGSSPT 585

  Fly   495 ----ITNKTQPATGNGSIGGVVIANGAVANIIDGGVVQGGTLERKSSGRGGVP-HGVHDQRSAN- 553
                :|..|.||..||.     ..||           ||.:|   |...|..| ||:.|.:... 
  Fly   586 TTTTLTLATSPAAPNGP-----KTNG-----------QGLSL---SPANGSTPVHGISDDKGKEI 631

  Fly   554 -----------------------PVQKP-PRLTDLPYSTQGYDNNGSVLS--TASCFISPSGS 590
                                   |.|.| |.:..|.||.....|:.:.|:  .|:..:.|.|:
  Fly   632 NFTFPVDDRVCTIDELMPSPPPPPQQHPHPNMGSLMYSVSHSPNSATTLAAVAAAATVIPPGA 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 3/16 (19%)
LRR_RI <119..277 CDD:238064 48/157 (31%)
leucine-rich repeat 123..148 CDD:275380 9/24 (38%)
LRR_8 148..207 CDD:290566 16/58 (28%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
LRR_8 195..255 CDD:290566 18/59 (31%)
leucine-rich repeat 197..220 CDD:275380 5/22 (23%)
leucine-rich repeat 221..244 CDD:275380 7/22 (32%)
leucine-rich repeat 245..268 CDD:275380 11/22 (50%)
LRRCT 277..327 CDD:214507 16/81 (20%)
IG_like 338..429 CDD:214653 15/110 (14%)
Ig 346..426 CDD:143165 13/99 (13%)
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_8 131..190 CDD:290566 8/27 (30%)
leucine-rich repeat 132..155 CDD:275380
LRR_RI 151..422 CDD:238064 72/266 (27%)
leucine-rich repeat 156..179 CDD:275380 3/16 (19%)
LRR_8 178..262 CDD:290566 25/85 (29%)
leucine-rich repeat 180..203 CDD:275380 9/24 (38%)
leucine-rich repeat 204..251 CDD:275380 13/46 (28%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRR_8 274..334 CDD:290566 22/60 (37%)
leucine-rich repeat 276..299 CDD:275380 7/22 (32%)
LRR_4 298..342 CDD:289563 17/44 (39%)
leucine-rich repeat 300..323 CDD:275380 11/22 (50%)
leucine-rich repeat 388..411 CDD:275380 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.