DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and SPOM_SPAC926.06C

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_594367.1 Gene:SPOM_SPAC926.06C / 2543531 PomBaseID:SPAC926.06C Length:621 Species:Schizosaccharomyces pombe


Alignment Length:250 Identity:63/250 - (25%)
Similarity:92/250 - (36%) Gaps:74/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EVYSIADS------QPMTEDGYMPPSQHFPPTHSDL---------------DPPAQQQSTCQTVC 94
            |:|....|      ||.::    |..||  |.|::|               .||. .::..|:|.
pombe   237 ELYRFRSSRQTYPQQPNSQ----PCEQH--PAHANLRRSVSLGSKDYLKSSHPPV-HKTLSQSVL 294

  Fly    95 ACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLR--NC 157
            .....|...:               ...|:  :.|.|...:|..:..|.::....|.||||  :|
pombe   295 VLSKDGNASS---------------SGGTE--NQSANSSSSLMEKDAILSSSSWSQLLYLRCSSC 342

  Fly   158 KIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLH 222
            |:..|.:..|..|.:||.||||.|.|..:| .|||.:|.|..|.||||.|        ....:.:
pombe   343 KLKSIPKNVFLSLQSLVSLDLSGNELTEIP-YALGELPQLCSLNLASNKI--------TGCRTFY 398

  Fly   223 KLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDN 277
            .:.|||..|..:|......|.||                  |.:..|..:::.||
pombe   399 HISLSHLQILVLSRNHLTSLSGL------------------ENVPSLEKLDIRDN 435

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 0/18 (0%)
LRR <122..>277 CDD:443914 45/156 (29%)
leucine-rich repeat 123..148 CDD:275380 5/24 (21%)
leucine-rich repeat 149..172 CDD:275380 10/24 (42%)
leucine-rich repeat 173..196 CDD:275380 12/22 (55%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
leucine-rich repeat 221..244 CDD:275380 6/22 (27%)
leucine-rich repeat 245..268 CDD:275380 2/22 (9%)