Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352040.1 | Gene: | Slitrk4 / 245446 | MGIID: | 2442509 | Length: | 837 | Species: | Mus musculus |
Alignment Length: | 380 | Identity: | 96/380 - (25%) |
---|---|---|---|
Similarity: | 153/380 - (40%) | Gaps: | 78/380 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MHIREAVFLVLTLLPGMILGTRYNQLHLYANGGASSSGPGGYRPAPSSQNEVYSIADSQPMTEDG 65
Fly 66 YMPPSQHF-----------PP--------------------------THSDLDPPAQQQSTCQTV 93
Fly 94 CACKWKGGK--QTVECIDRHLIQIPEHIDP---NTQVLDMSGNKLQTLSNEQFIRANLLNLQKLY 153
Fly 154 LRNCKIGEIERETFKGLTNLVELDLSHNLLVTV-PSLALGHIPSLRELTLASNHIHKIESQAFGN 217
Fly 218 TPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSEL-LPKTIETLSRLHGIELHDNPWLC 281
Fly 282 DCRLRDTKLWLMKRNIPYPVAPVCSGGPERIIDRSFADLHV----DEFACRPEML 332 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 5/21 (24%) |
LRR_RI | <119..277 | CDD:238064 | 46/162 (28%) | ||
leucine-rich repeat | 123..148 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 148..207 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 6/23 (26%) | ||
LRR_8 | 195..255 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 221..244 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 245..268 | CDD:275380 | 7/23 (30%) | ||
LRRCT | 277..327 | CDD:214507 | 17/53 (32%) | ||
IG_like | 338..429 | CDD:214653 | |||
Ig | 346..426 | CDD:143165 | |||
Slitrk4 | NP_001352040.1 | internalin_A | <15..>253 | CDD:380193 | 5/17 (29%) |
LRR 1 | 60..81 | ||||
leucine-rich repeat | 63..84 | CDD:275380 | |||
LRR_8 | 83..143 | CDD:404697 | |||
LRR 2 | 84..105 | ||||
leucine-rich repeat | 85..108 | CDD:275380 | |||
LRR 3 | 108..129 | ||||
leucine-rich repeat | 109..132 | CDD:275380 | |||
LRR 4 | 132..153 | ||||
leucine-rich repeat | 133..156 | CDD:275380 | |||
LRR 5 | 156..177 | ||||
leucine-rich repeat | 157..182 | CDD:275380 | |||
LRR 6 | 179..200 | ||||
leucine-rich repeat | 183..325 | CDD:275380 | 20/105 (19%) | ||
leucine-rich repeat | 326..402 | CDD:275380 | 16/79 (20%) | ||
leucine-rich repeat | 358..378 | CDD:275380 | 5/20 (25%) | ||
PPP1R42 | 359..>550 | CDD:411060 | 61/195 (31%) | ||
LRR 7 | 378..399 | 5/20 (25%) | |||
LRR_8 | 402..461 | CDD:404697 | 21/61 (34%) | ||
LRR 8 | 402..423 | 8/22 (36%) | |||
leucine-rich repeat | 403..426 | CDD:275380 | 9/24 (38%) | ||
LRR 9 | 426..447 | 6/20 (30%) | |||
leucine-rich repeat | 427..450 | CDD:275380 | 6/23 (26%) | ||
LRR 10 | 450..471 | 7/20 (35%) | |||
leucine-rich repeat | 451..472 | CDD:275380 | 7/20 (35%) | ||
LRR 11 | 474..495 | 4/20 (20%) | |||
leucine-rich repeat | 475..496 | CDD:275380 | 4/20 (20%) | ||
LRR 12 | 497..518 | 6/21 (29%) | |||
leucine-rich repeat | 498..522 | CDD:275380 | 7/23 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 113 | 1.000 | Inparanoid score | I4837 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |