| Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006538918.1 | Gene: | Lrrc38 / 242735 | MGIID: | 2442845 | Length: | 410 | Species: | Mus musculus |
| Alignment Length: | 214 | Identity: | 62/214 - (28%) |
|---|---|---|---|
| Similarity: | 93/214 - (43%) | Gaps: | 31/214 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFI-RANLLNLQKLY 153
Fly 154 LRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNT 218
Fly 219 PSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDC 283
Fly 284 RLRDTKLWLMKRNIPYPVA 302 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 7/18 (39%) |
| LRR_RI | <119..277 | CDD:238064 | 41/158 (26%) | ||
| leucine-rich repeat | 123..148 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 148..207 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 195..255 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 245..268 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 277..327 | CDD:214507 | 10/26 (38%) | ||
| IG_like | 338..429 | CDD:214653 | |||
| Ig | 346..426 | CDD:143165 | |||
| Lrrc38 | XP_006538918.1 | LRRNT | 171..202 | CDD:214470 | 11/32 (34%) |
| leucine-rich repeat | 182..204 | CDD:275380 | 7/21 (33%) | ||
| LRR_8 | 202..260 | CDD:338972 | 20/60 (33%) | ||
| leucine-rich repeat | 205..225 | CDD:275380 | 6/19 (32%) | ||
| leucine-rich repeat | 226..249 | CDD:275380 | 8/25 (32%) | ||
| leucine-rich repeat | 250..273 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 273..331 | CDD:338972 | 19/81 (23%) | ||
| leucine-rich repeat | 274..297 | CDD:275380 | 9/46 (20%) | ||
| leucine-rich repeat | 298..321 | CDD:275380 | 8/22 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||