Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006499531.1 | Gene: | Lrrc55 / 241528 | MGIID: | 2685197 | Length: | 311 | Species: | Mus musculus |
Alignment Length: | 268 | Identity: | 68/268 - (25%) |
---|---|---|---|
Similarity: | 103/268 - (38%) | Gaps: | 78/268 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 HSDLDPPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQF 141
Fly 142 IRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPS-----------LALGHIP 195
Fly 196 SLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLP 260
Fly 261 KTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSGGPERIIDRSFADLHVDEF 325
Fly 326 ACR--PEM 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 5/18 (28%) |
LRR_RI | <119..277 | CDD:238064 | 40/168 (24%) | ||
leucine-rich repeat | 123..148 | CDD:275380 | 3/24 (13%) | ||
LRR_8 | 148..207 | CDD:290566 | 21/69 (30%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 11/33 (33%) | ||
LRR_8 | 195..255 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 221..244 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 245..268 | CDD:275380 | 3/22 (14%) | ||
LRRCT | 277..327 | CDD:214507 | 13/49 (27%) | ||
IG_like | 338..429 | CDD:214653 | |||
Ig | 346..426 | CDD:143165 | |||
Lrrc55 | XP_006499531.1 | LRRNT | 51..82 | CDD:214470 | 9/34 (26%) |
leucine-rich repeat | 60..79 | CDD:275380 | 5/18 (28%) | ||
leucine-rich repeat | 80..103 | CDD:275380 | 3/24 (13%) | ||
LRR_8 | 103..161 | CDD:338972 | 18/57 (32%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 128..151 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 151..210 | CDD:338972 | 21/92 (23%) | ||
leucine-rich repeat | 152..176 | CDD:275380 | 8/33 (24%) | ||
leucine-rich repeat | 177..200 | CDD:275380 | 9/22 (41%) | ||
TPKR_C2 | 209..260 | CDD:387596 | 17/57 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |