| Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_780708.1 | Gene: | Slitrk6 / 239250 | MGIID: | 2443198 | Length: | 840 | Species: | Mus musculus |
| Alignment Length: | 236 | Identity: | 67/236 - (28%) |
|---|---|---|---|
| Similarity: | 107/236 - (45%) | Gaps: | 20/236 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 82 PPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMS--GNKLQTLSNEQFIRA 144
Fly 145 NLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHK 209
Fly 210 IESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKT--IETLSRLHGI 272
Fly 273 ELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSGGPERII 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 1/18 (6%) |
| LRR_RI | <119..277 | CDD:238064 | 45/161 (28%) | ||
| leucine-rich repeat | 123..148 | CDD:275380 | 6/26 (23%) | ||
| LRR_8 | 148..207 | CDD:290566 | 16/58 (28%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 195..255 | CDD:290566 | 19/59 (32%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 245..268 | CDD:275380 | 10/24 (42%) | ||
| LRRCT | 277..327 | CDD:214507 | 13/37 (35%) | ||
| IG_like | 338..429 | CDD:214653 | |||
| Ig | 346..426 | CDD:143165 | |||
| Slitrk6 | NP_780708.1 | leucine-rich repeat | 68..89 | CDD:275380 | 6/22 (27%) |
| LRR_8 | 69..124 | CDD:290566 | 18/56 (32%) | ||
| LRR 1 | 89..110 | 6/20 (30%) | |||
| leucine-rich repeat | 94..113 | CDD:275380 | 7/18 (39%) | ||
| LRR 2 | 113..134 | 5/20 (25%) | |||
| LRR_8 | 114..172 | CDD:290566 | 16/57 (28%) | ||
| leucine-rich repeat | 114..137 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 137..158 | 8/20 (40%) | |||
| leucine-rich repeat | 138..161 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 161..219 | CDD:290566 | 18/59 (31%) | ||
| LRR 4 | 161..182 | 5/20 (25%) | |||
| leucine-rich repeat | 162..177 | CDD:275380 | 4/14 (29%) | ||
| LRR 5 | 184..205 | 9/22 (41%) | |||
| leucine-rich repeat | 185..260 | CDD:275380 | 26/71 (37%) | ||
| leucine-rich repeat | 210..222 | CDD:275378 | 4/11 (36%) | ||
| TPKR_C2 | 218..268 | CDD:301599 | 13/37 (35%) | ||
| leucine-rich repeat | 261..411 | CDD:275380 | |||
| LRR 6 | 363..384 | ||||
| leucine-rich repeat | 365..387 | CDD:275380 | |||
| LRR_8 | 387..444 | CDD:290566 | |||
| LRR 7 | 387..408 | ||||
| LRR_4 | 388..426 | CDD:289563 | |||
| LRR_4 | 410..449 | CDD:289563 | |||
| LRR 8 | 411..432 | ||||
| leucine-rich repeat | 412..435 | CDD:275380 | |||
| LRR_8 | 435..493 | CDD:290566 | |||
| LRR 9 | 435..456 | ||||
| leucine-rich repeat | 436..459 | CDD:275380 | |||
| LRR 10 | 459..480 | ||||
| leucine-rich repeat | 460..481 | CDD:275380 | |||
| LRR 11 | 482..503 | ||||
| LRRCT | 516..566 | CDD:214507 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 717..736 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 113 | 1.000 | Inparanoid score | I4837 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||