DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and Lrit1

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_666357.2 Gene:Lrit1 / 239037 MGIID:2385320 Length:624 Species:Mus musculus


Alignment Length:373 Identity:105/373 - (28%)
Similarity:156/373 - (41%) Gaps:60/373 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LDPPAQQQSTCQTVCACKWK----GGK-QTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNE 139
            |..|.|....|.:.|:|..:    |.| :||.|.|..|...|..|.|:|                
Mouse    13 LGGPHQAWGFCPSECSCSLRILSDGSKARTVVCSDPDLTLPPASIPPDT---------------- 61

  Fly   140 QFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLAS 204
                      .||.|....|..:..|||:.|:.|.:|.|.:|.|..:.:|.|..:..||||.|..
Mouse    62 ----------CKLRLERTAIRRVPGETFRPLSRLEQLWLPYNALSELSALMLRGLRRLRELRLPG 116

  Fly   205 NHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKL----SELLP----- 260
            |.:......|..:||.|..|||....:.|:..:|...|:.||.|.|:.|:|    .|||.     
Mouse   117 NRLVTFPWAALRDTPQLQLLDLQANRLSTLPPEAAHFLENLTFLDLSNNQLMRLPEELLDVWAHL 181

  Fly   261 KTIETLSRLHG---IELHDNPWLCDCRLRDTKLWL---MKRNIPYPVAPVCSGGPERIIDRSFAD 319
            ||...||..|.   :.|.||||:|||||.|....|   :..|:.:..|.:....|..:...:|:.
Mouse   182 KTGPFLSGHHARLILGLQDNPWVCDCRLYDLVHLLDGWVSSNLIFIEARLRCASPRSLAGVAFSQ 246

  Fly   320 LHVDEFACR-PEMLPISHYVEAAMGENASITCRARAVPAANINW-YWNGRLLANNSAFTAYQRIH 382
            |.:.:  |: ||:.|....:.:.:|....:.|.|..:|...::| ..|||.|...        :|
Mouse   247 LELRK--CQSPELRPGVTSIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNGT--------VH 301

  Fly   383 MLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS 430
              ::|.......:.|.|......||.::.|.|:|..|.:|...:|.|:
Mouse   302 --QEVSSDGSSWTLLDLPVVSLFDSGDYICQAKNFLGASETLISLIVT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 7/18 (39%)
LRR_RI <119..277 CDD:238064 49/169 (29%)
leucine-rich repeat 123..148 CDD:275380 1/24 (4%)
LRR_8 148..207 CDD:290566 21/58 (36%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 195..255 CDD:290566 21/59 (36%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
leucine-rich repeat 221..244 CDD:275380 7/22 (32%)
leucine-rich repeat 245..268 CDD:275380 12/31 (39%)
LRRCT 277..327 CDD:214507 15/52 (29%)
IG_like 338..429 CDD:214653 21/91 (23%)
Ig 346..426 CDD:143165 19/80 (24%)
Lrit1NP_666357.2 LRRNT 23..61 CDD:214470 13/37 (35%)
LRR 1 60..81 8/46 (17%)
LRR_8 63..143 CDD:290566 28/79 (35%)
leucine-rich repeat 64..84 CDD:275378 7/19 (37%)
LRR 2 84..105 7/20 (35%)
leucine-rich repeat 85..132 CDD:275378 15/46 (33%)
LRR 3 108..129 7/20 (35%)
LRR_8 131..>176 CDD:290566 16/44 (36%)
LRR_4 131..172 CDD:289563 14/40 (35%)
LRR 4 132..153 6/20 (30%)
leucine-rich repeat 133..156 CDD:275378 7/22 (32%)
LRR 5 156..177 9/20 (45%)
leucine-rich repeat 157..180 CDD:275378 9/22 (41%)
leucine-rich repeat 181..205 CDD:275378 10/23 (43%)
TPKR_C2 201..>241 CDD:301599 13/39 (33%)
Ig 258..346 CDD:299845 22/97 (23%)
IG_like 268..346 CDD:214653 21/87 (24%)
FN3 432..502 CDD:214495
LRR 6 526..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.