DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and Rtn4rl1

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_006533288.1 Gene:Rtn4rl1 / 237847 MGIID:2661375 Length:498 Species:Mus musculus


Alignment Length:447 Identity:100/447 - (22%)
Similarity:159/447 - (35%) Gaps:98/447 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYL 154
            |...|.|  .....||.|...:...|||.|..:::.:.:..|::..|....|..|    :..|::
Mouse    78 CPRDCVC--YPAPMTVSCQAHNFAAIPEGIPEDSERIFLQNNRITFLQQGHFSPA----MVTLWI 136

  Fly   155 RNCKIGEIERETFKGLTNLVELDLSHNL-------------------------LVTVPSLALGHI 194
            .:..|..|...||:|..:|.||||..|.                         |..:|:...|.:
Mouse   137 YSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGL 201

  Fly   195 PSLRELTLASNHIHKIESQAF------------GN------------TPSLHKLDLSHCDIQTIS 235
            .||:.|.|..|||..::...|            ||            ..:|.:|.|....:|.:.
Mouse   202 HSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVH 266

  Fly   236 AQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYP 300
            .:||..|..||.|.|..|.|:||....:..|..|..:.|:.|.|.|.||.|....||.:......
Mouse   267 HKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSS 331

  Fly   301 VAPVCSGGPERIIDRSFADLHVDEFA-CRPEMLPISHYVEAAMGENASITCRARAVP---AANIN 361
            ..|..:  ||....:....|.|::|. |...:.|  |.:::.....:....|....|   |:...
Mouse   332 AVPCAT--PELRQGQDLKLLRVEDFRNCTGPVSP--HQIKSHTLTTSDRAARKEHHPSHGASRDK 392

  Fly   362 WYWNGRLLANNSAF-------TAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFY-------- 411
            .:.:|....:.|.:       |:::..:.:.:|..|.|      ||..|  |.:..|        
Mouse   393 GHPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKE------LTELQ--DYAPDYQHKFSFDI 449

  Fly   412 --CVAENRAGMAEANFTLHVSMRA-AGMASLGSGQIVGLSAALVALIVFALGVIMCL 465
              .....|.|..    .....:|| :|:....||..:|     ..|:.:.||:.:.|
Mouse   450 MPTARPKRKGKC----ARRTPIRAPSGVQQASSGTALG-----APLLAWILGLAVTL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 7/18 (39%)
LRR_RI <119..277 CDD:238064 48/206 (23%)
leucine-rich repeat 123..148 CDD:275380 4/24 (17%)
LRR_8 148..207 CDD:290566 20/83 (24%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
leucine-rich repeat 173..196 CDD:275380 9/47 (19%)
LRR_8 195..255 CDD:290566 22/83 (27%)
leucine-rich repeat 197..220 CDD:275380 9/46 (20%)
leucine-rich repeat 221..244 CDD:275380 7/22 (32%)
leucine-rich repeat 245..268 CDD:275380 9/22 (41%)
LRRCT 277..327 CDD:214507 14/50 (28%)
IG_like 338..429 CDD:214653 16/110 (15%)
Ig 346..426 CDD:143165 16/99 (16%)
Rtn4rl1XP_006533288.1 leucine-rich repeat 90..111 CDD:275380 7/20 (35%)
LRR <108..>308 CDD:227223 47/203 (23%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 155..179 CDD:275380 6/23 (26%)
leucine-rich repeat 180..203 CDD:275380 3/22 (14%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
LRR_8 227..286 CDD:338972 14/58 (24%)
leucine-rich repeat 228..251 CDD:275380 2/22 (9%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
leucine-rich repeat 276..299 CDD:275380 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.