| Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_505402.1 | Gene: | lron-2 / 179309 | WormBaseID: | WBGene00022789 | Length: | 575 | Species: | Caenorhabditis elegans |
| Alignment Length: | 316 | Identity: | 77/316 - (24%) |
|---|---|---|---|
| Similarity: | 118/316 - (37%) | Gaps: | 61/316 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MHIREAVFLVLTLLPGMILGTRYNQLHLYANGGASSSGPGGYRP-------APSSQNEVYSIADS 58
Fly 59 QPMTEDGYMPPSQHFPPTHSDLDPPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNT 123
Fly 124 QVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEI-------------------------- 162
Fly 163 ----ERETFKGLTNLVELDLSHNLLVTVPSLAL-GHIPSLRELTLASNHIHKIESQAFGNTPSLH 222
Fly 223 KLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNP 278 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 5/18 (28%) |
| LRR_RI | <119..277 | CDD:238064 | 50/188 (27%) | ||
| leucine-rich repeat | 123..148 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 148..207 | CDD:290566 | 24/89 (27%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 8/52 (15%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 10/23 (43%) | ||
| LRR_8 | 195..255 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 245..268 | CDD:275380 | 6/22 (27%) | ||
| LRRCT | 277..327 | CDD:214507 | 1/2 (50%) | ||
| IG_like | 338..429 | CDD:214653 | |||
| Ig | 346..426 | CDD:143165 | |||
| lron-2 | NP_505402.1 | leucine-rich repeat | 64..84 | CDD:275380 | 4/28 (14%) |
| leucine-rich repeat | 85..109 | CDD:275380 | 4/24 (17%) | ||
| LRR_8 | 86..144 | CDD:290566 | 17/61 (28%) | ||
| LRR_RI | 109..294 | CDD:238064 | 50/189 (26%) | ||
| leucine-rich repeat | 110..133 | CDD:275380 | 6/25 (24%) | ||
| LRR_8 | 132..198 | CDD:290566 | 15/65 (23%) | ||
| leucine-rich repeat | 134..157 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 161..187 | CDD:275380 | 2/25 (8%) | ||
| leucine-rich repeat | 188..211 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 212..270 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 213..235 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 236..259 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 260..283 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 282..342 | CDD:290566 | 2/12 (17%) | ||
| leucine-rich repeat | 284..307 | CDD:275380 | 2/10 (20%) | ||
| leucine-rich repeat | 308..355 | CDD:275380 | |||
| LRR_8 | 330..390 | CDD:290566 | |||
| leucine-rich repeat | 356..377 | CDD:275380 | |||
| leucine-rich repeat | 380..400 | CDD:275380 | |||
| Ca_hom_mod | <481..>504 | CDD:291464 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24366 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||