DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and iglr-3

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001293349.1 Gene:iglr-3 / 171771 WormBaseID:WBGene00021353 Length:488 Species:Caenorhabditis elegans


Alignment Length:433 Identity:97/433 - (22%)
Similarity:158/433 - (36%) Gaps:102/433 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 STCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGN---KLQTLSNEQFIRANLLNL 149
            |.....|...|...:.:.:|....| |.|..:.||...|.:|.|   ::.|..:|      ...|
 Worm    17 SNAPKTCKSFWISNRPSQDCASLTL-QEPPQLLPNVLSLSLSNNSIFRITTFPSE------YRRL 74

  Fly   150 QKLYLRNCKIGEIERETFKGLTNLVELDLSHNLL--VTVPSLALGHIPSLRELTLASNHIHKIES 212
            |.|.|..|::.:::.:.......|.|||:|.|.|  :.:|.    ::.|||.|.||.|       
 Worm    75 QSLRLDQCQLEKLDFDALSVFEQLRELDVSRNSLSKLIIPR----NLASLRVLNLAFN------- 128

  Fly   213 QAFGNTP------SLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHG 271
             ||...|      ||..:||||..:.::..:...  ..|.::||..|:...|.|...  |.:|..
 Worm   129 -AFTYVPDMSHLESLRLVDLSHNRLISVRPRMLP--FNLEVVRLAANRFQHLSPWPF--LHKLQE 188

  Fly   272 IELHDNPWLCDCRLRDTKLWLMK-----------------RNIPYPVAPVC-----SGGPERIID 314
            :::..|...|||.|.....|..|                 |..|.....||     :..||..: 
 Worm   189 LDVTFNDLECDCSLWHFVTWAEKLALFDSTMLPCRRPSELRKSPIDGKTVCGPTVVTSSPESAV- 252

  Fly   315 RSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQ 379
            .|..|.||                         :.|.|.|.|:..:.|.:||:.::     :...
 Worm   253 VSLDDAHV-------------------------MCCTALATPSPQLYWQFNGKNIS-----SGLS 287

  Fly   380 RIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSGQI 444
            :.|:.|..:..|    .|.:...:..|..::.||| :.||: .::...||......:....:..|
 Worm   288 QKHLSESGKLEF----CLEIPKVRLKDMGKYKCVA-SLAGL-NSSKEFHVERDKIPIVLNSAEGI 346

  Fly   445 VGLSAALVALIVFALGVIMCLLLRV------KRQP---YVDSK 478
            :......:...:....||.|.:||.      |.:|   |:.:|
 Worm   347 MIYCQFTICTFIGVCCVISCCVLRTGGGGRGKTRPNREYLHTK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 4/18 (22%)
LRR_RI <119..277 CDD:238064 44/168 (26%)
leucine-rich repeat 123..148 CDD:275380 5/27 (19%)
LRR_8 148..207 CDD:290566 20/60 (33%)
leucine-rich repeat 149..172 CDD:275380 5/22 (23%)
leucine-rich repeat 173..196 CDD:275380 8/24 (33%)
LRR_8 195..255 CDD:290566 20/65 (31%)
leucine-rich repeat 197..220 CDD:275380 9/28 (32%)
leucine-rich repeat 221..244 CDD:275380 5/22 (23%)
leucine-rich repeat 245..268 CDD:275380 7/22 (32%)
LRRCT 277..327 CDD:214507 17/71 (24%)
IG_like 338..429 CDD:214653 17/90 (19%)
Ig 346..426 CDD:143165 17/79 (22%)
iglr-3NP_001293349.1 LRR <47..>196 CDD:227223 45/170 (26%)
leucine-rich repeat 51..73 CDD:275380 5/27 (19%)
leucine-rich repeat 74..97 CDD:275380 5/22 (23%)
leucine-rich repeat 98..119 CDD:275380 8/24 (33%)
leucine-rich repeat 120..141 CDD:275380 9/28 (32%)
leucine-rich repeat 142..163 CDD:275380 5/22 (23%)
leucine-rich repeat 164..185 CDD:275380 7/22 (32%)
Ig_3 243..319 CDD:372822 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.