| Sequence 1: | NP_001303320.1 | Gene: | kek1 / 34688 | FlyBaseID: | FBgn0015399 | Length: | 880 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245160.1 | Gene: | waif2 / 100884149 | ZFINID: | ZDB-GENE-120209-3 | Length: | 313 | Species: | Danio rerio |
| Alignment Length: | 218 | Identity: | 67/218 - (30%) |
|---|---|---|---|
| Similarity: | 97/218 - (44%) | Gaps: | 21/218 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 QSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIR--ANLLNL 149
Fly 150 QKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLA-------SNHI 207
Fly 208 HKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLS--RLH 270
Fly 271 GIELHDNPWLCDC-RLRDTKLWL 292 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek1 | NP_001303320.1 | leucine-rich repeat | 103..122 | CDD:275380 | 5/18 (28%) |
| LRR_RI | <119..277 | CDD:238064 | 50/168 (30%) | ||
| leucine-rich repeat | 123..148 | CDD:275380 | 6/26 (23%) | ||
| LRR_8 | 148..207 | CDD:290566 | 23/65 (35%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 195..255 | CDD:290566 | 21/66 (32%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 7/29 (24%) | ||
| leucine-rich repeat | 221..244 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 245..268 | CDD:275380 | 8/24 (33%) | ||
| LRRCT | 277..327 | CDD:214507 | 9/17 (53%) | ||
| IG_like | 338..429 | CDD:214653 | |||
| Ig | 346..426 | CDD:143165 | |||
| waif2 | NP_001245160.1 | LRRNT | 11..42 | CDD:214470 | 8/34 (24%) |
| leucine-rich repeat | 42..68 | CDD:275380 | 5/25 (20%) | ||
| LRR_RI | <68..156 | CDD:238064 | 30/91 (33%) | ||
| LRR_8 | 68..126 | CDD:290566 | 22/57 (39%) | ||
| leucine-rich repeat | 69..92 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 93..116 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 117..143 | CDD:275380 | 7/29 (24%) | ||
| LRR_8 | 142..203 | CDD:290566 | 20/61 (33%) | ||
| LRR_4 | 143..182 | CDD:289563 | 15/39 (38%) | ||
| leucine-rich repeat | 144..166 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 167..190 | CDD:275380 | 7/22 (32%) | ||
| TPKR_C2 | 201..246 | CDD:301599 | 9/17 (53%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||