DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrit3

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_002934296.2 Gene:lrit3 / 100494489 XenbaseID:XB-GENE-6076513 Length:652 Species:Xenopus tropicalis


Alignment Length:148 Identity:27/148 - (18%)
Similarity:44/148 - (29%) Gaps:65/148 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TRDNFLLKMPESDFDAVINVNLKGTWLVLQRFGRAMIEHELAGSMVNVSSIVARTGN-------- 150
            |:....|:.|...|.:.:||.|.|                          |||...|        
 Frog    37 TQTTIALEQPICMFKSAVNVYLIG--------------------------IVAGAPNTPLYDGNK 75

  Fly   151 -IGQSNYSPSKAG-----------------VEAMTKV-----VAREFGRYNIRVNAIVP------ 186
             :..|.||.::.|                 ::|::.:     |.....:|.:||.|.|.      
 Frog    76 KVNASTYSGTQGGKTGPYIVAKLPNQQCINIQALSNMADPTQVQSILSKYVVRVGADVTCLTNPN 140

  Fly   187 --GFIHTPMTGTVPQKVK 202
              |:.:.|:.|......|
 Frog   141 FVGYCNAPLQGNTQYSFK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 6/18 (33%)
LRR <122..>277 CDD:443914 19/120 (16%)
leucine-rich repeat 123..148 CDD:275380 3/24 (13%)
leucine-rich repeat 149..172 CDD:275380 7/53 (13%)
leucine-rich repeat 173..196 CDD:275380 7/30 (23%)
leucine-rich repeat 197..220 CDD:275380 1/6 (17%)
leucine-rich repeat 221..244 CDD:275380
leucine-rich repeat 245..268 CDD:275380
LRRCT 277..327 CDD:214507
IG_like 338..429 CDD:214653
Ig strand B 346..350 CDD:409353
Ig strand C 359..363 CDD:409353
Ig strand E 395..399 CDD:409353
Ig strand F 409..414 CDD:409353
Ig strand G 422..425 CDD:409353
lrit3XP_002934296.2 leucine-rich repeat 59..82 CDD:275378 6/48 (13%)
LRR <61..>172 CDD:443914 19/98 (19%)
leucine-rich repeat 83..106 CDD:275378 2/22 (9%)
leucine-rich repeat 107..130 CDD:275378 4/22 (18%)
leucine-rich repeat 131..154 CDD:275378 5/22 (23%)
leucine-rich repeat 155..168 CDD:275378 1/4 (25%)
Ig_3 255..334 CDD:464046
FN3 455..518 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.