DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and lrfn4b

DIOPT Version :9

Sequence 1:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_021333806.1 Gene:lrfn4b / 100149980 ZFINID:ZDB-GENE-070705-473 Length:1131 Species:Danio rerio


Alignment Length:156 Identity:34/156 - (21%)
Similarity:57/156 - (36%) Gaps:29/156 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IREAVFLVLTLLPGMILGTRYNQLHLYANGGASSSGPGGYR---PAPSSQNEVYSIADSQPMTED 64
            :.:.|:|....||..:...:.:|..:.....|....|..||   |.....|..:.::..:|:...
Zfish   984 VGQRVWLATKNLPLRVESRKLSQRFIGPFRIARKVNPVSYRLYLPRSLRINPTFHVSLLKPVLSS 1048

  Fly    65 GYMPPSQHFPP-----------THSDLDPPAQQQSTCQTVCACKWKG-GKQTVECIDRHLIQIPE 117
            .:.||.:..||           .|..||....|.|....|   .|:| |.:     :|..|...:
Zfish  1049 PFAPPRRPPPPPRIIDGQPAYTVHRILDSRRVQNSLQYLV---DWEGYGPE-----ERSWIPAKD 1105

  Fly   118 HIDP------NTQVLDMSGNKLQTLS 137
            .:||      :||....||..:::.|
Zfish  1106 ILDPSLIREFHTQRPGCSGRNVRSRS 1131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 4/24 (17%)
LRR_RI <119..277 CDD:238064 7/25 (28%)
leucine-rich repeat 123..148 CDD:275380 5/15 (33%)
LRR_8 148..207 CDD:290566
leucine-rich repeat 149..172 CDD:275380
leucine-rich repeat 173..196 CDD:275380
LRR_8 195..255 CDD:290566
leucine-rich repeat 197..220 CDD:275380
leucine-rich repeat 221..244 CDD:275380
leucine-rich repeat 245..268 CDD:275380
LRRCT 277..327 CDD:214507
IG_like 338..429 CDD:214653
Ig 346..426 CDD:143165
lrfn4bXP_021333806.1 retropepsin_like 58..144 CDD:133136
RT_LTR 253..429 CDD:238825
RNase_HI_RT_Ty3 525..646 CDD:260006
zf-H2C2 716..749 CDD:324145
rve 772..885 CDD:307008
Chromo 1069..1116 CDD:306815 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26535
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.