DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and GXYLT2

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001073862.1 Gene:GXYLT2 / 727936 HGNCID:33383 Length:443 Species:Homo sapiens


Alignment Length:140 Identity:25/140 - (17%)
Similarity:47/140 - (33%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 YPTPGLVPD-----------------------YMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMAN 250
            :|.||.:|.                       .:..|.|:    ||:..:...|....::..:|.
Human    54 WPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKLARR----PGEPRSFQAVLPPELWIHLAV 114

  Fly   251 VSVPNTKPELQEMLKSG-----EAVPFHMDICEAC--HRGPNLEEWINASVVSKELNVFNVGHRS 308
            |:..|...|...||||.     ..:.||:...::.  .....|.:|.::.....|..::.:....
Human   115 VACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSV 179

  Fly   309 ENNNNWEPIF 318
            .|...|:.:|
Human   180 GNPQEWKKLF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 25/140 (18%)
GXYLT2NP_001073862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..84 4/29 (14%)
GT8_like_2 110..413 CDD:133052 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.