DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and gxylt2

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001103670.1 Gene:gxylt2 / 567541 ZFINID:ZDB-GENE-070424-64 Length:441 Species:Danio rerio


Alignment Length:185 Identity:38/185 - (20%)
Similarity:59/185 - (31%) Gaps:78/185 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PPETTLREPANCSGPPPYENVVKGNMYRSRNTLDYPVNMGRNVARRASLTHYVLASDIELYPTPG 213
            ||:...:||...|...  |||:.....:|        .:||   .|:.:|               
Zfish    67 PPKLIRKEPKLSSRRA--ENVIAKTRLKS--------EVGR---PRSKVT--------------- 103

  Fly   214 LVPDYMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSG-----EAVPFH 273
            |..|.||                           :|.|:..|...|...|:||.     :.:.||
Zfish   104 LAEDVMH---------------------------LAVVACGNRLDETLNMVKSALLFSMKKIKFH 141

  Fly   274 M----DICEACHRGPNLEEWINASVVSKELN------VFNVGHRSENNNNWEPIF 318
            :    |:.|...||  ..:|  ...:|...:      .|:||    |.:.|:.:|
Zfish   142 IFAEEDLAEQFERG--FSQW--PQTLSSRFHYSIYPITFSVG----NADEWKKLF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 38/185 (21%)
gxylt2NP_001103670.1 GT8_like_2 109..412 CDD:133052 23/115 (20%)
RfaJ 109..>340 CDD:224359 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579636
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.