powered by:
Protein Alignment CG15483 and xxylt1
DIOPT Version :9
Sequence 1: | NP_609592.1 |
Gene: | CG15483 / 34687 |
FlyBaseID: | FBgn0032457 |
Length: | 407 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005155910.1 |
Gene: | xxylt1 / 449721 |
ZFINID: | ZDB-GENE-120521-2 |
Length: | 387 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 11/47 - (23%) |
Similarity: | 22/47 - (46%) |
Gaps: | 7/47 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 364 KPG--IKQPGNRKEIFPQARRTNGL-----IDKKISREMRMMYGSRN 403
:|| ..:||...|:..:.:|.:.| :||.:|.:.:.....|:
Zfish 73 QPGHLESRPGAGAELEGKPKRFHALMMFTKVDKSLSLQQKFQTAMRS 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3765 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.