DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and large2

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001004538.1 Gene:large2 / 446214 ZFINID:ZDB-GENE-050419-253 Length:750 Species:Danio rerio


Alignment Length:375 Identity:80/375 - (21%)
Similarity:135/375 - (36%) Gaps:94/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LEISCLE-NGTLAKLKKFVNCESKAYKSSNAIYKD-------------------------YWVLE 56
            |.::.|| :|.|.:.:.| .|.|:|...|..:.:.                         |::..
Zfish   394 LYLTFLEYDGNLLRRELF-GCPSQASSESTVLQQALEELDEDDQCYDFRRERIMLHRVHLYFLQY 457

  Fly    57 NYVMADHGDIPCYSNVTYTTHADYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIHSILYLLQC 121
            .|...|.|     :::|.........|..:..:.:.|..|:|||:|....:.:..:.        
Zfish   458 EYSPTDDG-----TDITLVAQLSMDRLQMLEAICKHWEGPISLALYMSDAEAQQFLR-------- 509

  Fly   122 HPGHDLVRQLCSIHLYFDVEHLPQVVLPPETTLREPANCSGPPPYENVVKGNMYRSRNTLDYPVN 186
                           |.....:          |:...|..    |..|.|...:       ||||
Zfish   510 ---------------YAQASEV----------LKNRKNVG----YHIVYKEGQF-------YPVN 538

  Fly   187 MGRNVARRASLTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMA-N 250
            :.||||.|...|.||..:|::..|..||. ||   |.:.::.:........|  |:..||.:. .
Zfish   539 LVRNVALRNVNTPYVFLTDVDFLPMYGLY-DY---LRKSIVQLDMANTKKAL--VVPAFETLRYR 597

  Fly   251 VSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWINASVVSKELNVFNVGHRSENNNNWE 315
            :|.|.:|.||..||..|....|...:....|...|..:|..|:          ..::.|...::|
Zfish   598 LSFPKSKAELLSMLDMGTLYTFRYHVWTKGHAPTNYAKWRTAT----------TPYKVEWEADFE 652

  Fly   316 PIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHILDNAFLVHKP 365
            |..:...:.|.||:|....|. :|::....:...:|:..:|.|||::|.|
Zfish   653 PYVVVRRDCPEYDQRFVGFGW-NKVSHIMELDAQEYDLIVLPNAFMIHMP 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 66/296 (22%)
large2NP_001004538.1 GT8_LARGE_C 132..411 CDD:133053 5/16 (31%)
Xylosyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 132..407 5/12 (42%)
Glucuronyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 408..750 75/361 (21%)
Glyco_transf_49 467..736 CDD:316419 66/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.