DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and shams

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster


Alignment Length:346 Identity:59/346 - (17%)
Similarity:96/346 - (27%) Gaps:150/346 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LAKLKKFVNCESKAYKSSNAIYKDYWVLENYVMADHGDIPCYSNVTYTTHADYTYLDNVVPLLER 92
            ||.|..||:            .:..||.||     .|.:..|:.                  |:.
  Fly    14 LAILSYFVH------------QRPSWVTEN-----KGKMLGYNE------------------LQT 43

  Fly    93 WRSPLSLAIYAPGTDFEPTIHSILYLLQCHPGHDLVRQLCSIHLYFDVEHLPQVVLPPETTLREP 157
            .:.||.:.:.:.|...:.|               ||....:|...:|.|:|..|:...:.     
  Fly    44 GKPPLYIVVVSCGQRVQET---------------LVMIKSAILFNYDEEYLKFVIFTEDG----- 88

  Fly   158 ANCSGPPPYENVVKGNMYRSRNT----------------LDYPVNMGRNV----------ARRAS 196
                         ||:.:|.:.|                |.:|  .|..|          |:|..
  Fly    89 -------------KGDEFREKLTDWRDIKPFTFDFEILPLKFP--SGNEVEWRNLFKPCAAQRLF 138

  Fly   197 LTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMANVSVPNTKPELQ 261
            |...:...|..||....::     ||             ||:..:.|.|:......:....||  
  Fly   139 LPSLLTHVDSLLYVDTDIL-----FL-------------SPISDIWRFFKKFNETQMSALTPE-- 183

  Fly   262 EMLKSGEAVPFHMDICEACHRGPNLEEWINASV---------VSKELNVFNVGHRSENNNNWEPI 317
                               |...|: .|.|...         |:..:.:.|:....|  ..||..
  Fly   184 -------------------HENENI-GWYNRFARHPFYGRLGVNSGVMLMNLTRMRE--MKWEQH 226

  Fly   318 FLGTVEDPPYDERLTWEGQRD 338
            .:...::  |..|:.| |.:|
  Fly   227 IVSIHKE--YKLRIIW-GDQD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 48/303 (16%)
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 46/277 (17%)
RfaJ 64..>270 CDD:224359 42/246 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447384
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.