DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and CG3253

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster


Alignment Length:396 Identity:96/396 - (24%)
Similarity:166/396 - (41%) Gaps:66/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NCESKAYKSSNAIY-----------KDYWVL-ENYVMADHGDIPCYSNVTYTTHADYTYLDNVVP 88
            |..|.|:.:.|..|           ||:.:| |.||.:..|.:.|.:     |......|:::..
  Fly     9 NSASLAFDNINLSYGRWDNQLLYRIKDFALLGEQYVDSSEGSLVCLA-----TQTSVERLNSLPQ 68

  Fly    89 LLERWRSPLSLAIYAPG-TDFEPTIHSILYLLQCHPGHDLVRQLCSIHLYF--DVEHLPQVVLPP 150
            :...|:..:|:|::|.| .:|....:.:.|:..|...   :|:..:.||..  |.:.||:|...|
  Fly    69 VAANWQGKMSVALFAAGPEEFVVLQYFVTYMRLCFAN---IRENATFHLLTPRDFDKLPRVAALP 130

  Fly   151 ETTLREPANCSGPPPYENVVKGNM---------YRSRNTLDYPVNMGRNVARRASLTHYVLASDI 206
             ..:|...:|..|   :..:|..:         :|.|||  ||.|..||:||:...|.||..:||
  Fly   131 -LNMRGKFDCQYP---DRTLKALLKFRSLKTLQWRQRNT--YPQNHMRNLARKGCQTKYVFLTDI 189

  Fly   207 ELYPTPGLVPDYMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVP 271
            ::.|:...||...||...       ...|....:|:..||:....:.|.:|..|..:::.|.|.|
  Fly   190 DIVPSTNSVPQLNHFFRT-------ANCTKSCAYVIPTFEIDVRATFPRSKNALVRLIRKGLARP 247

  Fly   272 FHMDICEACHRGPNLEEWINASVVSKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQ 336
            ||..:........|..:|::.:....|::|.:|....|  ..:||.::.....|.:|||....| 
  Fly   248 FHEKVFIYNQYATNFSKWLSPNTNETEVSVSHVVTNFE--FLYEPFYIAVDNAPAHDERFLGYG- 309

  Fly   337 RDKMTQAYAMCVLDYEFHILDNAFLVH--------KPGIKQPGN----------RKEIFPQARRT 383
            ..:.:|.|.|.:..|:|::|...|..|        :|..::..|          :.|||.:.:..
  Fly   310 FTRNSQVYEMHIAGYQFYVLSPVFTGHWGLQRKQARPAWREQQNNANRRKFDVFKSEIFVRYKND 374

  Fly   384 NGLIDK 389
            ..|:.|
  Fly   375 PRLLLK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 83/349 (24%)
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 82/342 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 1 1.000 - - otm14638
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.