DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and Xxylt1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_344028.5 Gene:Xxylt1 / 363799 RGDID:1308154 Length:392 Species:Rattus norvegicus


Alignment Length:218 Identity:48/218 - (22%)
Similarity:78/218 - (35%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ESKAYKSSNAIYKDYWVLENYVMADHGDIPCYSNVTYTTHADYTYLDNVVPLLERWRSPLSLAIY 102
            ::|..:...|:..||.:|..:..|:|       |......|....           ||.|.||  
  Rat    84 KAKNLEGGLAVPVDYHLLMMFTKAEH-------NAALQAKARVAL-----------RSLLRLA-- 128

  Fly   103 APGTDFEPTIHSILYL------LQCHPGHDLVRQL--------CSIHLYFDVEHLPQVVLPPETT 153
                .|||  |.:|.|      ........|:|:|        |.: ::.||..|...:.|....
  Rat   129 ----KFEP--HEVLNLHFVSEEASREVAKALLRELLPPAAGFKCKV-IFHDVAVLTDKLFPVVEA 186

  Fly   154 LREPANCSGPPPYENVVKGNMYR-SRNTLDYPVN--MGRNVARRASLTHYVLASDIEL-YPT--P 212
            :::         |.:...|..|. |...|...::  |.:.:.|       ::..|::| |.|  .
  Rat   187 MQK---------YFSAGSGTYYSDSIFFLSVAMHQIMPKEILR-------IIQLDLDLKYKTNIR 235

  Fly   213 GLVPDYMHFLGRQVIGIPGQ-QP 234
            .|..::.:||...||||..: ||
  Rat   236 ELFEEFDNFLPGAVIGIAREMQP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 41/185 (22%)
Xxylt1XP_344028.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.