DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and Large1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001101909.1 Gene:Large1 / 361368 RGDID:1308895 Length:385 Species:Rattus norvegicus


Alignment Length:183 Identity:37/183 - (20%)
Similarity:66/183 - (36%) Gaps:45/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CSGPPPYENV---VKGNMYRSRNTLDYPVNMGRNVARRASLTHYVLASDIELYPTPGLVPDYMHF 221
            |:|.....:|   ||..::..||.|.:.:     :|  .|:...:||:..:.:..|.:..|:.:.
  Rat   144 CAGYNASRDVVTLVKSVLFHRRNPLHFHL-----IA--DSIAEQILATLFQTWMVPAVRVDFYNA 201

  Fly   222 --LGRQVIGIPGQQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGP 284
              |..:|..||.:       |...|:.:|..|........|:.::.....:.|..||.|.     
  Rat   202 DELKSEVSWIPNK-------HYSGIYGLMKLVLTKTLPANLERVIVLDTDITFATDIAEL----- 254

  Fly   285 NLEEWINASVVSKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQR 337
                |    .|..:.....|....||.::|   :||.:          |:..|
  Rat   255 ----W----AVFHKFKGQQVLGLVENQSDW---YLGNL----------WKNHR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 37/183 (20%)
Large1NP_001101909.1 RfaJ 136..>359 CDD:224359 37/183 (20%)
GT8_LARGE_C 138..377 CDD:133053 37/183 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.