DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and Gxylt1

DIOPT Version :10

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001094357.1 Gene:Gxylt1 / 300173 RGDID:1563062 Length:435 Species:Rattus norvegicus


Alignment Length:151 Identity:28/151 - (18%)
Similarity:56/151 - (37%) Gaps:48/151 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 THADYTYLDNVVPLLERWR-----------------SPLSLAIYAPGTDFEPTIHSI-------- 115
            |.|...:.|.::|||::::                 :|.||.::....::.|. |.|        
  Rat   287 TTARLQWGDILMPLLKKYKLNITWGDQDLLNIMFYHNPESLFVFPCQWNYRPD-HCIYGSNCREA 350

  Fly   116 ----LYLLQCHPG--HD-----------LVRQLCSIHLYFDVEHLPQVVLPPETTLREPANCSGP 163
                :::|..:.|  ||           .:|. ||:    :.:.:..::.|.|..|::..:....
  Rat   351 EEEGVFILHGNRGVYHDDKQPAFRAMYEALRN-CSL----EDDSVRSLLKPLELELQKTVHTYCG 410

  Fly   164 PPYENVVKGNMYRSRNTLDYP 184
            ..|:..:|......||..|.|
  Rat   411 KTYKIFIKQLAKSIRNRYDTP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..400 CDD:464027 28/151 (19%)
Gxylt1NP_001094357.1 GT8_like_2 111..411 CDD:133052 22/129 (17%)

Return to query results.
Submit another query.