DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and Gxylt1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001094357.1 Gene:Gxylt1 / 300173 RGDID:1563062 Length:435 Species:Rattus norvegicus


Alignment Length:151 Identity:28/151 - (18%)
Similarity:56/151 - (37%) Gaps:48/151 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 THADYTYLDNVVPLLERWR-----------------SPLSLAIYAPGTDFEPTIHSI-------- 115
            |.|...:.|.::|||::::                 :|.||.::....::.|. |.|        
  Rat   287 TTARLQWGDILMPLLKKYKLNITWGDQDLLNIMFYHNPESLFVFPCQWNYRPD-HCIYGSNCREA 350

  Fly   116 ----LYLLQCHPG--HD-----------LVRQLCSIHLYFDVEHLPQVVLPPETTLREPANCSGP 163
                :::|..:.|  ||           .:|. ||:    :.:.:..::.|.|..|::..:....
  Rat   351 EEEGVFILHGNRGVYHDDKQPAFRAMYEALRN-CSL----EDDSVRSLLKPLELELQKTVHTYCG 410

  Fly   164 PPYENVVKGNMYRSRNTLDYP 184
            ..|:..:|......||..|.|
  Rat   411 KTYKIFIKQLAKSIRNRYDTP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 28/151 (19%)
Gxylt1NP_001094357.1 GT8_like_2 111..411 CDD:133052 22/129 (17%)
RfaJ <183..>340 CDD:224359 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.