DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and B4gat1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001099794.1 Gene:B4gat1 / 293667 RGDID:1309541 Length:415 Species:Rattus norvegicus


Alignment Length:372 Identity:94/372 - (25%)
Similarity:162/372 - (43%) Gaps:66/372 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VMADHGDIPCY----------SNVTYTTHADYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIH 113
            |:...||...|          ::|...|||....|.::..|||||..|||::::| .|..|..:.
  Rat    72 VLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFA-ATREEAQLA 135

  Fly   114 SIL-YLLQCHPGHDLVRQLCSIHLYFDVEHLPQVVLPPETTLREPA------NCSGPPPYENVVK 171
            ::| |.|..|...  :|...::||.....:...|..|     |||.      :|.  ..::.:.:
  Rat   136 TVLAYALSSHCPE--MRARVAMHLVCPSRYEAAVPDP-----REPGEFALLRSCQ--EVFDKLAR 191

  Fly   172 ----GNMYRSRNTLDYPVNMGRNVARRASLTHYVLASDIELYPTPGL-------VPDYMHFLGRQ 225
                |..|.....:.||.|:.||:||..:  :|.|..|:::.|:.||       :....|:.|..
  Rat   192 VAQPGINYALGTNISYPNNLLRNLAREEA--NYALVIDVDMVPSEGLWRSLREMLDQSNHWDGTA 254

  Fly   226 VIGIPGQQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWI 290
            :: :|.             ||:.....:|..|.||.::.:.||..||:..:|..||...|...|:
  Rat   255 LV-VPA-------------FEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCHAPTNYSRWV 305

  Fly   291 NASVVSKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHI 355
            |....|.....:.|..|    :.|||.::...:.|.:|||....| .::::||..:.:..:.|.:
  Rat   306 NLPEESLLRPAYVVPWR----DPWEPFYVAGGKVPTFDERFRQYG-FNRISQACELHMAGFNFEV 365

  Fly   356 LDNAFLVHKPGIKQPGNRKEIFPQ---ARRTNGLIDKKISREMRMMY 399
            |:..||||| |.|:   ..:..||   ..:.|.::.::..:|::..|
  Rat   366 LNEGFLVHK-GFKE---ALKFHPQKEAENQRNKILYRQFKQELKARY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 89/348 (26%)
B4gat1NP_001099794.1 Glyco_transf_49 94..408 CDD:404735 89/348 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.