DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and Gxylt1

DIOPT Version :10

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001333714.1 Gene:Gxylt1 / 223827 MGIID:2684933 Length:435 Species:Mus musculus


Alignment Length:87 Identity:19/87 - (21%)
Similarity:31/87 - (35%) Gaps:25/87 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GTLAKLKKFVNCESKAYKSSNAIYKDYWVLENYVMADHGDIPCYSNVTYTTHADYTYLDNVVPLL 90
            |...:.|:|          |.:.:..||:|.:.|        |..|..:  .|.:.|     .:.
Mouse    65 GRTGRCKEF----------SLSYWNPYWMLPSDV--------CGMNCFW--EAAFRY-----DMK 104

  Fly    91 ERWRSPLSLAIYAPGTDFEPTI 112
            .|....:.||:.|.|...|.|:
Mouse   105 TRPDEKMHLAVVACGERLEETV 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..400 CDD:464027 10/42 (24%)
Gxylt1NP_001333714.1 GT8_like_2 111..411 CDD:133052 6/16 (38%)

Return to query results.
Submit another query.