DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and bgnt-1.7

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001364608.1 Gene:bgnt-1.7 / 188531 WormBaseID:WBGene00011779 Length:399 Species:Caenorhabditis elegans


Alignment Length:310 Identity:75/310 - (24%)
Similarity:125/310 - (40%) Gaps:44/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VTYTTHADYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIHSILYLLQCHPGHDLVRQLCSIHL 136
            :|...|.....|..:......|..|:|..::   .||. :.|::.|:...|..|...|:..::|.
 Worm    77 ITLAVHGSPEVLGEIENKPFNWDGPISFGLF---IDFH-SQHALNYISMLHKCHADFRRKTTVHF 137

  Fly   137 YFDVEHLPQVVLPPETTLREPANCSGPPPYENVVKGNM-YRSRNT--LD--------YPVNMGRN 190
            .|.:               .|:....|..|.:..|..: :..:||  |:        ||:|:.||
 Worm   138 AFRI---------------SPSQTECPVIYTSGYKDCVTFFQKNTELLEEMEDPFQIYPINLMRN 187

  Fly   191 VARRASLTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMANVSVPN 255
            :|||.:.:...|..|.::..:............|.:.|:..|      |.|:|.||. ....:|.
 Worm   188 IARRGAKSDLHLIVDTDMVMSTNFAKMVKPVANRMIDGMNKQ------VLVVRRFET-NETELPL 245

  Fly   256 TKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWINASVVSKELNVFNVGHRSENNNNWE-PIFL 319
            ...||::.|.:.....||.......|:.|||.||...|..|:|...:.:.:   ..::|| .|.|
 Worm   246 NLDELEQGLLNENTFEFHHSFFFVGHQIPNLSEWFENSYASEETTAWEIPY---TGSDWEVQIIL 307

  Fly   320 GTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHILDNAFLVHKPGIKQ 369
            .  .:.||:........||..:..|.:|..:|.|::|.:.|.||| |||:
 Worm   308 H--RNDPYNIEYFPSRVRDMQSLIYKLCRANYTFNLLSHVFNVHK-GIKE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 75/310 (24%)
bgnt-1.7NP_001364608.1 Glyco_transf_49 76..387 CDD:404735 75/310 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14638
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.