DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15483 and XXYLT1

DIOPT Version :9

Sequence 1:	NP_609592.1	Gene:	CG15483 / 34687	FlyBaseID:	FBgn0032457	Length:	407	Species:	Drosophila melanogaster
Sequence 2:	NP_689744.3	Gene:	XXYLT1 / 152002	HGNCID:	26639	Length:	393	Species:	Homo sapiens

Alignment Length:	87	Identity:	17/87 - (19%)
Similarity:	26/87 - (29%)	Gaps:	32/87 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    79 DYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIHSILYLLQCHPGHDLVRQLCSIHLYFDVEHL 143
            |..:..|:..|.|.:.|.|..||.....:.:|...                     |.::...|
Human   228 DLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYR---------------------HTFWQFRH- 270

  Fly   144 PQVVLPPETTLREPANCSGPPP 165
                ..|:|.:      .||||
Human   271 ----ENPQTRV------GGPPP 282

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15483	NP_609592.1	Glyco_transf_49	71..399	CDD:290607	17/87 (20%)
XXYLT1	NP_689744.3	UDP-alpha-D-xylose binding. /evidence=ECO:0000250\|UniProtKB:Q3U4G3	104..106
		Glyco_tranf_GTA_type	120..383	CDD:299700	17/87 (20%)
		RfaJ	162..>353	CDD:224359	17/87 (20%)
		Interaction with target proteins. /evidence=ECO:0000250\|UniProtKB:Q3U4G3	263..266		1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3765
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900