DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and B4GAT1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_006867.1 Gene:B4GAT1 / 11041 HGNCID:15685 Length:415 Species:Homo sapiens


Alignment Length:367 Identity:95/367 - (25%)
Similarity:166/367 - (45%) Gaps:56/367 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VMADHGDIPCY----------SNVTYTTHADYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIH 113
            |:...||...|          ::|...|||....|.::..|||||..|||::::| .|..|..:.
Human    72 VLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFA-ATKEEAQLA 135

  Fly   114 SIL-YLLQCH-PGHDLVRQLCSIHLYFDVEHLPQVVLPPETTLREPA------NCSGPPPYENVV 170
            ::| |.|..| |.   :|...::||.....:...|..|     |||.      :|.  ..::.:.
Human   136 TVLAYALSSHCPD---MRARVAMHLVCPSRYEAAVPDP-----REPGEFALLRSCQ--EVFDKLA 190

  Fly   171 K----GNMYRSRNTLDYPVNMGRNVARRASLTHYVLASDIELYPTPGLVPDYMHFLG-RQVIGIP 230
            :    |..|.....:.||.|:.||:||..:  :|.|..|:::.|:.||      :.| |:::...
Human   191 RVAQPGINYALGTNVSYPNNLLRNLAREGA--NYALVIDVDMVPSEGL------WRGLREMLDQS 247

  Fly   231 GQQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWINASVV 295
            .|...:.|  |:..||:.....:|..|.||.::.:.||..||:..:|..|....|...|:|.   
Human   248 NQWGGTAL--VVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTNYSRWVNL--- 307

  Fly   296 SKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHILDNAF 360
             .|.::....:.....:.|||.::...:.|.:|||....| .::::||..:.|..::|.:|:..|
Human   308 -PEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYG-FNRISQACELHVAGFDFEVLNEGF 370

  Fly   361 LVHKPGIKQPGNRKEIFPQ---ARRTNGLIDKKISREMRMMY 399
            |||| |.|:   ..:..||   ..:.|.::.::..:|::..|
Human   371 LVHK-GFKE---ALKFHPQKEAENQHNKILYRQFKQELKAKY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 90/343 (26%)
B4GAT1NP_006867.1 Glyco_transf_49 94..408 CDD:404735 90/343 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.