DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and B4gat1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_780592.1 Gene:B4gat1 / 108902 MGIID:1919680 Length:415 Species:Mus musculus


Alignment Length:372 Identity:95/372 - (25%)
Similarity:162/372 - (43%) Gaps:66/372 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VMADHGDIPCY----------SNVTYTTHADYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIH 113
            |:...||...|          ::|...|||....|.::..|||||..|||::::| .|..|..:.
Mouse    72 VLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFA-ATKEEAQLA 135

  Fly   114 SIL-YLLQCHPGHDLVRQLCSIHLYFDVEHLPQVVLPPETTLREPA------NCSGPPPYENVVK 171
            ::| |.|..|...  :|...::||.....:...|..|     |||.      :|.  ..::.:.:
Mouse   136 TVLAYALSSHCPE--MRARVAMHLVCPSRYEAAVPDP-----REPGEFALLRSCQ--EVFDKLAR 191

  Fly   172 ----GNMYRSRNTLDYPVNMGRNVARRASLTHYVLASDIELYPTPGL-------VPDYMHFLGRQ 225
                |..|.......||.|:.||:||..:  :|.|..|:::.|:.||       :....|:.|..
Mouse   192 VAQPGINYALGTNTSYPNNLLRNLAREEA--NYALVIDVDMVPSEGLWRGLREMLDQSNHWDGTA 254

  Fly   226 VIGIPGQQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWI 290
            :: :|.             ||:..:..:|..|.||.::.:.||..||:..:|..||...|...|:
Mouse   255 LV-VPA-------------FEIRRSRRMPMNKNELVQLYQVGEVRPFYYGLCTPCHAPTNYSRWV 305

  Fly   291 NASVVSKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHI 355
            |....|.....:.|..|    :.|||.::...:.|.:|||....| .::::||..:.|..:.|.:
Mouse   306 NLPEESLLRPAYVVPWR----DPWEPFYVAGGKVPTFDERFRQYG-FNRISQACELHVAGFNFEV 365

  Fly   356 LDNAFLVHKPGIKQPGNRKEIFPQ---ARRTNGLIDKKISREMRMMY 399
            |:..||||| |.|:   ..:..||   ..:.|.::.::..:|::..|
Mouse   366 LNEGFLVHK-GFKE---ALKFHPQKEAENQRNKILYRQFKQELKARY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 90/348 (26%)
B4gat1NP_780592.1 Glyco_transf_49 94..408 CDD:290607 90/348 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836176
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6619
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.