DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and b4gat1

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_002939368.2 Gene:b4gat1 / 100170600 XenbaseID:XB-GENE-1007367 Length:421 Species:Xenopus tropicalis


Alignment Length:428 Identity:112/428 - (26%)
Similarity:178/428 - (41%) Gaps:53/428 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRISGLLSSLVVLTFVLEISCLEN--------------GTL-------AKLKKFVNCESKAYKSS 45
            ||::.:...||.|..:|.:|.|.|              ||.       .:||:.:    :|.|..
 Frog    10 FRVALIALLLVALLQLLYLSLLSNLHGQQQRSAYPVPVGTSHTGSQSHRELKEHL----RAAKVG 70

  Fly    46 NAIYK--DYWVLENYVMADHG---DIPCYSNVTYTTHADYTYLDNVVPLLERWRSPLSLAIYAPG 105
            ..:..  .||:..:.:..:.|   |:    :|...:||....|.::..|::.|...:|||::|..
 Frog    71 GILDSSGQYWIYRHLLPHEKGNWKDL----DVVLASHASVNNLGHLQDLVQHWDGRISLALFASN 131

  Fly   106 TDFEPTIHSILYLLQCHPGHDLVRQLCSIHLYFDVEHLPQVVLPPETTLREPA---NCSGPPPYE 167
            ..........:|.|.....|  |||..|.||.  .:...:|..|....|.:.|   ||.......
 Frog   132 AVQAKLAVMFVYALSQLCPH--VRQRVSFHLV--CKSSDRVTFPELEDLSDFATLPNCEAVFSKA 192

  Fly   168 NVVKGNMYRSRNTLDYPVNMGRNVARRA-SLTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPG 231
            ..:...:........||.|:.|||||.. ....|||..||::.|:.||...:::.....|     
 Frog   193 ADMGIKVVNYAGNASYPNNLLRNVARAGIESAAYVLVVDIDMVPSEGLRSGFVNLATGGV----- 252

  Fly   232 QQPTSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWINASVVS 296
               ...||.|:..||:.....:|:||.||..:.:.||...|:.::|..|....|...|||.. ..
 Frog   253 ---DQHLVFVVPAFEIRHTRRLPSTKEELMRLYQVGEVRAFYEELCPRCQAPTNYSLWINLP-EK 313

  Fly   297 KELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHILDNAFL 361
            |......|.:..|..:.|||.::|..:.|.||||....| .::::||..:.:..:.|.:||:|||
 Frog   314 KPAAKLGVAYVVEWKDPWEPFYIGRADVPAYDERFKQYG-FNRISQACELNMAGFSFAVLDSAFL 377

  Fly   362 VHKPGIKQPGNRKEIFPQARRTNGLIDKKISREMRMMY 399
            :|| |.|.||:.........|.|..:.:....|:|:.|
 Frog   378 LHK-GHKLPGDFHSQKDAENRRNRQLYRGFKEELRLRY 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 92/331 (28%)
b4gat1XP_002939368.2 Glyco_transf_49 97..414 CDD:404735 92/331 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.