DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15483 and large2

DIOPT Version :9

Sequence 1:NP_609592.1 Gene:CG15483 / 34687 FlyBaseID:FBgn0032457 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001096468.1 Gene:large2 / 100125087 XenbaseID:XB-GENE-5871953 Length:723 Species:Xenopus tropicalis


Alignment Length:389 Identity:87/389 - (22%)
Similarity:135/389 - (34%) Gaps:124/389 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPCYSNVTYTTH--ADYTYLDNVVPLLERWRSPLSLAIYAPGTDFEPTIH--------SIL--YL 118
            :|||.||..:.|  ::..|.:.....:..|.||..|.:.....:...|::        |:|  .|
 Frog   321 LPCYWNVQLSDHTRSEQCYSELADLKVIHWNSPHKLRVKNKHVELFRTLYLTFLEYDGSLLRREL 385

  Fly   119 LQC--------------------HPGHDLVRQ-LCS--IHLYFDVEHLPQVVLPPETTLREPANC 160
            :.|                    .|.:|..|: |.|  :||.|    ||.|..||:         
 Frog   386 IGCPSEGEQQGGSQAALSQLDEEDPCYDFRRESLASHRVHLSF----LPHVTPPPD--------- 437

  Fly   161 SGPPPYE------------------------------------------------------NVVK 171
                ||:                                                      ||..
 Frog   438 ----PYDVTLVAQLSMDRLQMLELICRHWDGPMSLALYLSDAEAQQFLRYAQASEVLQSRTNVAY 498

  Fly   172 GNMYRSRNTLDYPVNMGRNVARRASLTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQPTS 236
            ..:|:....  ||||:.||||.:.|.|.||..|||:..|..||.......:.:|.:..|.:....
 Frog   499 HVVYKEGQL--YPVNLLRNVALKNSQTPYVFLSDIDFLPMYGLYEYLRKSISQQDLTGPPKALIV 561

  Fly   237 PLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWINASVVSKELNV 301
            |....||.     .:|.|.:|.||..||.:|....|...:.|..|...:..:|..|:        
 Frog   562 PAFETLRY-----RLSFPKSKAELLSMLDTGALYTFRYHVWEKGHAPTDYAKWRTAT-------- 613

  Fly   302 FNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLDYEFHILDNAFLVHKP 365
              ..:|.|...::||..:...:.|.||:|....|. :|::....:...::|..:|.|||::|.|
 Frog   614 --TPYRVEWAPDFEPYVVVRRDCPEYDQRFLGFGW-NKVSHIMELDAQEHELLVLPNAFIIHMP 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15483NP_609592.1 Glyco_transf_49 71..399 CDD:290607 84/384 (22%)
large2NP_001096468.1 GT8_LARGE_C 107..386 CDD:133053 14/64 (22%)
Glyco_transf_49 440..709 CDD:290607 56/253 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.