DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRP and NAP5

DIOPT Version :9

Sequence 1:NP_723772.2 Gene:MRP / 34686 FlyBaseID:FBgn0032456 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:349 Identity:122/349 - (34%)
Similarity:182/349 - (52%) Gaps:55/349 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   736 DRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSA 800
            ||:||:|||:||:|..|::|||.||.|.|||:||||||||||||.:|||:|.|||:||.|||.||
plant     2 DRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFSA 66

  Fly   801 VDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAF 865
            ||||.|.|:|:|.:  :|:|..||.:.|||.|.|||..|...|:|.|.||::|.::.::      
plant    67 VDAHTGSHLFKEAL--RGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYNDIL------ 123

  Fly   866 ADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGG 930
                                    ||.| |..||:|..::::.:..:   :|:.||:...:|...
plant   124 ------------------------ISGT-DFRELIGAHQESLAVVGS---ADASSVSENSALDEE 160

  Fly   931 GGSLRRR---TKRQDSHDSVASAASLKKKQ----EVEGKLIETEKSQTGGVEFAVYKHYIK-SVG 987
            .|.:|..   ..:|:|.|       ||..:    |.:.:.::.|:...|.|...||..||. :.|
plant   161 NGVVRDDIGFDGKQESQD-------LKNDKLDSGEPQRQFVQEEERAKGSVALDVYWKYITLAYG 218

  Fly   988 IFLSVATLVLNFVFQAFQIGSNLWLTQWAN--DQNVANDTGLRDMYLGVYGAFGFGQGVLAYFAV 1050
            ..|....|:...:||..|||||.|:. ||.  .::|.....|..:.: ||.|..||..:......
plant   219 GALVPFILLGQILFQLLQIGSNYWMA-WATPISEDVQAPVKLSTLMV-VYVALAFGSSLCILVRA 281

  Fly  1051 VIVYLGGFQAAKTIHNELLAVIIR 1074
            .::...|::.|..:.:::...|.|
plant   282 TLLVTAGYKTATELFHKMHHCIFR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPNP_723772.2 MRP_assoc_pro 14..1548 CDD:188098 122/349 (35%)
ABC_membrane 338..601 CDD:279056
ABCC_MRP_domain1 649..848 CDD:213217 68/111 (61%)
ABC_membrane 988..1260 CDD:279056 23/89 (26%)
ABCC_MRP_domain2 1308..1528 CDD:213211
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 68/111 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 1 1.000 - - FOG0000087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.