DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRP and LOC110439293

DIOPT Version :9

Sequence 1:NP_723772.2 Gene:MRP / 34686 FlyBaseID:FBgn0032456 Length:1549 Species:Drosophila melanogaster
Sequence 2:XP_021330365.1 Gene:LOC110439293 / 110439293 -ID:- Length:174 Species:Danio rerio


Alignment Length:158 Identity:51/158 - (32%)
Similarity:73/158 - (46%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDRFCG----STFWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYLKASLDRNIPW 69
            ||..|.    ...|:...||||..||.|.||:.|.|||.||.:.|....|...|||...:..|..
Zfish     1 MDTLCSLSGLDPLWDWNVTWYTAHPDLTKCFQHTILVWFPCFYLWICAPFYCLYLKFYDNGRISI 65

  Fly    70 NKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFLLLFIFIPLNRKY 134
            :.|..:|..:.|.|.....|:.:..||::..|.|..:..|  ..|||:..|.:|..:.|.|.|..
Zfish    66 SSLCCAKTGLALCLASFGFLETVYLLVERRRDIEHHMVFL--LSPIIRSLTMILAMLMIHLERLR 128

  Fly   135 GVQTTGCQFIFWFLLTVLSIPRCRTEVR 162
            |.:::...|:||.|..|.|:...|..::
Zfish   129 GFRSSMFLFLFWMLAVVCSLVPLRANIQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPNP_723772.2 MRP_assoc_pro 14..1548 CDD:188098 48/153 (31%)
ABC_membrane 338..601 CDD:279056
ABCC_MRP_domain1 649..848 CDD:213217
ABC_membrane 988..1260 CDD:279056
ABCC_MRP_domain2 1308..1528 CDD:213211
LOC110439293XP_021330365.1 SunT 5..>161 CDD:331423 49/154 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.