DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRP and ABCC4

DIOPT Version :10

Sequence 1:NP_723772.2 Gene:MRP / 34686 FlyBaseID:FBgn0032456 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_005836.2 Gene:ABCC4 / 10257 HGNCID:55 Length:1325 Species:Homo sapiens


Alignment Length:119 Identity:26/119 - (21%)
Similarity:44/119 - (36%) Gaps:33/119 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 KHDNRVWALCVTRDESMFYSGGSDSQLIQWQDVTESKRQQELDQRKDTLLQEQELSNLLSERKLL 652
            |..|.|..|  ..||:.|              :.|..|||||.:::   .:|:||..|...|..|
Human    74 KFKNMVRGL--DEDETNF--------------LDEVSRQQELIEKQ---RREEELEELKEYRSNL 119

  Fly   653 KALRLS--------------LNLDRPLSTLKIVNEVIRTKEQGLEDTVRKLSND 692
            ..:.:|              :......|..|::...::.|.....::|::|..|
Human   120 NKVGISAENKEVEKKLAVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPNP_723772.2 MRP_assoc_pro 14..1548 CDD:188098 26/119 (22%)
ABCC4NP_005836.2 PLN03130 12..1277 CDD:215595 26/119 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 657..688
PDZ-binding 1322..1325
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.