DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and PIH1

DIOPT Version :10

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_011899.1 Gene:PIH1 / 856429 SGDID:S000001076 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:42/184 - (22%)
Similarity:64/184 - (34%) Gaps:65/184 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 PNTILRG---SGSGNRCRDTSSNRPMGPNQNRRSRLPNADEAAPSVAHSGGPIQDGTNLNRRINK 691
            |.:||||   .|..|...|..:..|:.|.:|:               .||..|:: .:.|...::
Yeast   197 PMSILRGRNDDGDDNNDPDDGTLPPLFPIENK---------------ISGAKIEE-IDKNEIAHR 245

  Fly   692 NLNPGKGPDRINAGTPNQPRSKSTTSQTRNLNPDIPNKMVK---------KSAVPQDNRAPQPNK 747
            ||.....|    |..|::.:.            |:|...||         |..:..:|:||    
Yeast   246 NLKQAPAP----APAPHEQQE------------DVPEYEVKMKRFKGAAYKLRILIENKAP---- 290

  Fly   748 PMNTNPGASKPGQSVIKPKLQATKINAAMAKPL--------AGIK----RKAET 789
              |:.|....|..:..:..|.   ||..::.||        |.||    ||..|
Yeast   291 --NSKPDRFSPSYNFAENILY---INGKLSIPLPRDIVVNAADIKIFHIRKERT 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PTZ00441 <161..416 CDD:240420
Pox_A30L_A26L <406..620 CDD:452796
PIH1NP_011899.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 32..165 CDD:469641
Pih1_fungal_CS 265..344 CDD:436535 21/84 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.