DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and Pih1d1

DIOPT Version :9

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_001265136.1 Gene:Pih1d1 / 68845 MGIID:1916095 Length:290 Species:Mus musculus


Alignment Length:260 Identity:48/260 - (18%)
Similarity:75/260 - (28%) Gaps:109/260 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 SRGGDTVRFPR---------------REDDT--------------FQGS------NNPNFPP--- 627
            |.|.:||||..               |.|.|              .:|.      ::|:.||   
Mouse    16 SMGEETVRFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINICHSPSIPPPAD 80

  Fly   628 -----------------------NYPNTILRGSGSGNRCRDTSSNRPMGPNQNRRSRLPNAD--- 666
                                   ..|:..|...|.|....|      :..|.|...|:.|:|   
Mouse    81 VTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYD------VAVNSNFYLRMQNSDFLR 139

  Fly   667 EAAPSVAHSGGPIQDGTNLN---RRI----------NKNLNPGKGPDRINAGTPNQPRSKSTTSQ 718
            |...::|..|...:.|..||   |.:          .:|:...:.|.....||.:...|..|...
Mouse   140 ELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTCHG 204

  Fly   719 TR----NLNPDIPNKMVKKSAVPQ------------DNR----APQ------PNKPMNTNPGASK 757
            ..    ||..:.|:.::.:..:|:            :||    .||      ...|:..|..||:
Mouse   205 PERPHLNLWLEAPDLLLAEVDLPKLDGAQGLALEIGENRLVIGGPQQLYHLDATVPLRINSEASR 269

  Fly   758  757
            Mouse   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PHA02896 <406..620 CDD:165222 9/47 (19%)
Pih1d1NP_001265136.1 alpha-crystallin-Hsps_p23-like 33..180 CDD:412199 25/152 (16%)
PIH1_CS <215..286 CDD:408028 10/55 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9914
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.