powered by:
Protein Alignment Pih1D1 and pih1d1
DIOPT Version :9
Sequence 1: | NP_723771.4 |
Gene: | Pih1D1 / 34685 |
FlyBaseID: | FBgn0032455 |
Length: | 1094 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001153400.1 |
Gene: | pih1d1 / 553260 |
ZFINID: | ZDB-GENE-050309-147 |
Length: | 293 |
Species: | Danio rerio |
Alignment Length: | 33 |
Identity: | 12/33 - (36%) |
Similarity: | 20/33 - (60%) |
Gaps: | 2/33 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 972 GLEKNTFSHYRNMRSIFLLMNEKFLNSLSDEQL 1004
||| |.:| ....|.|.:|.|.||:.|::::.:
Zfish 153 GLE-NKYS-LELSRDIKILKNRKFMGSIAEQNI 183
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4356 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H9914 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4625 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.930 |
|
Return to query results.
Submit another query.