DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and DNAAF2

DIOPT Version :9

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_060609.2 Gene:DNAAF2 / 55172 HGNCID:20188 Length:837 Species:Homo sapiens


Alignment Length:402 Identity:77/402 - (19%)
Similarity:125/402 - (31%) Gaps:138/402 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 EGIRRQFDPELDRRNLNDNFNQRNNYSRGGDTVR------FPRREDDTFQGSNNPNFPPNYPNTI 633
            |.:.:||..:|||||.. ....:...:.....:|      .|.|.|...:|. .|:||  ||   
Human   170 EAVEKQFGVKLDRRNAK-TLKAKYKGTPEAAVLRTPLPGVIPARPDGEPKGP-LPDFP--YP--- 227

  Fly   634 LRGSGSGNRCRDTSSNRPMGPNQNRRSRLPNADEAAPSVAHSGGPIQDGTNLNRRINKNLNPGKG 698
                          ...|..|.    .|.|:..|||                       |.|   
Human   228 --------------YQYPAAPG----PRAPSPPEAA-----------------------LQP--- 248

  Fly   699 PDRINAGTPNQPRSKSTTSQ---------TRNLNPD-IPNKMVKKSAVP---------------- 737
                   .|.:||.......         :|:..|. :|:::|....:|                
Human   249 -------APTEPRYSVVQRHHVDLQDYRCSRDSAPSPVPHELVITIELPLLRSAEQAALEVTRKL 306

  Fly   738 --QDNRAP----QPNKPMNTNPGASKPGQSVIKPKLQAT---KINAAMAKPLAGIKRKA--ETTP 791
              .|:|.|    :.:.|...:.|..|...:..:.:|..|   .:.||..:|...:...|  |:..
Human   307 LCLDSRKPDYRLRLSLPYPVDDGRGKAQFNKARRQLVVTLPVVLPAARREPAVAVAAAAPEESAD 371

  Fly   792 KLG--GAT-------KAGPKRQRADRTDRSFIIGG-------------ISLPYINSNTKKLPQPE 834
            :.|  |..       :|||.|.||:.......:.|             ::.|...:..:::|:|.
Human   372 RSGTDGQACASAREGEAGPARSRAEDGGHDTCVAGAAGSGVTTLGDPEVAPPPAAAGEERVPKPG 436

  Fly   835 EQSYAVTFFEQTPNYNTNIYAIDDGHVDEDEGDGDDEEMSDAESLDSNRSGVLSKWKGRSSKK-- 897
            ||.  ::....:|          .|.|:|....|::..........|:||.......||.|.:  
Human   437 EQD--LSRHAGSP----------PGSVEEPSPGGENSPGGGGSPCLSSRSLAWGSSAGRESARGD 489

  Fly   898 -KVRTQLRKEWT 908
             .|.|:...|.|
Human   490 SSVETREESEGT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PHA02896 <406..620 CDD:165222 12/50 (24%)
DNAAF2NP_060609.2 PIH1 43..348 CDD:285409 43/235 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..224 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..249 9/55 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..515 31/151 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4625
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.