DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and pih1d2

DIOPT Version :9

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:XP_009289837.1 Gene:pih1d2 / 494086 ZFINID:ZDB-GENE-041212-54 Length:341 Species:Danio rerio


Alignment Length:164 Identity:31/164 - (18%)
Similarity:51/164 - (31%) Gaps:53/164 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 AYPHEFNRNIRNDNEQEFNHNRNAVNDEFNRNTRNVNNQAFPQGHNHNNRNANAQFNRKTFDENP 385
            |:..|..:....|.|::.|....|:|             ...|.||            .|..::.
Zfish   112 AFNPEVLQTTEKDKEEKENLCLLALN-------------FIQQQHN------------LTLSQHY 151

  Fly   386 NFNNQRFQGPNHQINYRVQMPNNDHSQVNNNRRPGNQNFVSNQQPNLDRNAIS--------DDGI 442
            ...|.:.:|....:..|:.......|.:|     |:|   |...|:|.:...|        |..|
Zfish   152 KLTNDKIKGSFRDMKQRLMSTKTCKSTLN-----GSQ---SEPAPSLLQQICSLQNTESDEDSSI 208

  Fly   443 QLPRDRFRSP------------EAHPKQPPYPRN 464
            :|..::.|.|            |....||..|::
Zfish   209 ELSIEQERKPARSGLIEVISSTELDQPQPQLPKH 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PHA02896 <406..620 CDD:165222 17/79 (22%)
pih1d2XP_009289837.1 alpha-crystallin-Hsps_p23-like 51..318 CDD:294116 31/164 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.