DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and PIH1D2

DIOPT Version :10

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:XP_016872690.1 Gene:PIH1D2 / 120379 HGNCID:25210 Length:316 Species:Homo sapiens


Alignment Length:106 Identity:23/106 - (21%)
Similarity:37/106 - (34%) Gaps:41/106 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 DGTNLNRRINKNLNPGKGPDRINAGTPNQPRSKSTTSQTRNLNPD-IPNKMVKKSAVPQDNRAPQ 744
            |..:|..::.:.|..|            |.|| ||.|     ||| .|..::.|..|        
Human   172 DSIDLREKMRRELTLG------------QIRS-STMS-----NPDHFPQLLLPKDQV-------- 210

  Fly   745 PNKPMNTNPGASKPGQSV-IKPKLQATKINAAMAKPLAGIK 784
                         .|::| :..::.:|:|...|..|...:|
Human   211 -------------SGKAVCLIEEISSTEIQVEMKMPAYELK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PTZ00441 <161..416 CDD:240420
Pox_A30L_A26L <406..620 CDD:452796
PIH1D2XP_016872690.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 25..160 CDD:469641
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.