DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and PIH1D2

DIOPT Version :9

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:XP_016872690.1 Gene:PIH1D2 / 120379 HGNCID:25210 Length:316 Species:Homo sapiens


Alignment Length:106 Identity:23/106 - (21%)
Similarity:37/106 - (34%) Gaps:41/106 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 DGTNLNRRINKNLNPGKGPDRINAGTPNQPRSKSTTSQTRNLNPD-IPNKMVKKSAVPQDNRAPQ 744
            |..:|..::.:.|..|            |.|| ||.|     ||| .|..::.|..|        
Human   172 DSIDLREKMRRELTLG------------QIRS-STMS-----NPDHFPQLLLPKDQV-------- 210

  Fly   745 PNKPMNTNPGASKPGQSV-IKPKLQATKINAAMAKPLAGIK 784
                         .|::| :..::.:|:|...|..|...:|
Human   211 -------------SGKAVCLIEEISSTEIQVEMKMPAYELK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PHA02896 <406..620 CDD:165222
PIH1D2XP_016872690.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.