DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and pih1d1

DIOPT Version :9

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_001107356.1 Gene:pih1d1 / 100135181 XenbaseID:XB-GENE-1013257 Length:297 Species:Xenopus tropicalis


Alignment Length:215 Identity:45/215 - (20%)
Similarity:81/215 - (37%) Gaps:71/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 YIN-SNTKKLPQPEEQSYA--VTFFE-QTPNYNTNIYAIDDGHVDED-EGDGDD--EEMSDAESL 879
            :|| ..|..:|.|.:.|..  |...| ..|:......:|.:.||:.| .|:|..  |.:.::...
 Frog    64 FINICKTNDIPAPPDLSEVELVNILESDDPSGYRVPMSIGEPHVEVDNSGNGCTVYEIVINSTFF 128

  Fly   880 DSNRSGVLSK-------WKGRSSKKKVRTQLRKEWTKIYRTNNYKDWHAWWRDFKWCGSEINKKL 937
            |..:|..|.:       .:|..:|.::  :|.::|..:             ::.|:.||      
 Frog   129 DKMKSNELFREFFITVAMEGLENKYEM--ELSRDWRML-------------KNRKFMGS------ 172

  Fly   938 EKFGDRNLRHRFAPI--------GRKPMTGKTINQIFKS--------------GH-------MGL 973
              ..|:|:|.:..||        .:||.:...|::|..|              ||       :.|
 Frog   173 --ISDQNIRTKSKPIIQEMDTSASQKPQSKPLISEIKSSPEVPKYTIVAEPAEGHPSFLVAEISL 235

  Fly   974 EKNTFSHYRNMRSIFLLMNE 993
            .|.|     ::||:.|.:.|
 Frog   236 PKVT-----SVRSLVLDLGE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PHA02896 <406..620 CDD:165222
pih1d1NP_001107356.1 alpha-crystallin-Hsps_p23-like 12..294 CDD:294116 45/215 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9914
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4625
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.